Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 1619383..1619902 Replicon chromosome
Accession NZ_OX352941
Organism Streptococcus suis isolate 861160_WT

Toxin (Protein)


Gene name yoeB Uniprot ID A0A2K1SXY6
Locus tag QNH71_RS07845 Protein ID WP_012775363.1
Coordinates 1619383..1619640 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A0K2E7Z9
Locus tag QNH71_RS07850 Protein ID WP_002939010.1
Coordinates 1619642..1619902 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH71_RS07825 1615104..1616834 - 1731 WP_024387386.1 membrane protein -
QNH71_RS07830 1617295..1617768 - 474 WP_024378560.1 IS200/IS605 family transposase -
QNH71_RS07835 1617948..1618820 - 873 WP_024387385.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QNH71_RS07840 1618839..1619369 - 531 WP_074390182.1 DUF1697 domain-containing protein -
QNH71_RS07845 1619383..1619640 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin Toxin
QNH71_RS07850 1619642..1619902 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QNH71_RS07855 1619978..1620433 - 456 WP_074390181.1 8-oxo-dGTP diphosphatase -
QNH71_RS07860 1620440..1620769 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin -
QNH71_RS07865 1620759..1621046 - 288 WP_012028535.1 hypothetical protein -
QNH71_RS07870 1621144..1621512 - 369 WP_012775453.1 hypothetical protein -
QNH71_RS07875 1621505..1622074 - 570 WP_012775700.1 ribonuclease M5 -
QNH71_RS07880 1622058..1622840 - 783 WP_012028536.1 TatD family hydrolase -
QNH71_RS07885 1622947..1623084 - 138 WP_002939016.1 50S ribosomal protein L34 -
QNH71_RS07890 1623252..1624247 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1595960..1622840 26880
- flank IS/Tn - - 1617295..1617768 473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(1-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10346.81 Da        Isoelectric Point: 7.2737

>T296673 WP_012775363.1 NZ_OX352941:c1619640-1619383 [Streptococcus suis]
MGIHFTDDAWEDYLYWQGQDKKTLKRINKIIQDMQRHPFEGIAKPEPLKYDYQGAWSRRIDAENRLIYMVEADRLCILSL
KDHYR

Download         Length: 258 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9980.36 Da        Isoelectric Point: 5.7134

>AT296673 WP_002939010.1 NZ_OX352941:c1619902-1619642 [Streptococcus suis]
MEAIVYSHFRNHLKDYMKKVNDEFEPLVVVNKNPEEDIVVLSKSEWDSLQETLAVARNTYLSQKVLRGMAKVKTGQTQER
NLIEAD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1SXY6

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E7Z9

References