Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 1955113..1955632 Replicon chromosome
Accession NZ_OX352806
Organism Streptococcus suis isolate 861160_dxerD_hsdSA

Toxin (Protein)


Gene name yoeB Uniprot ID A0A2K1SXY6
Locus tag QNH74_RS09540 Protein ID WP_012775363.1
Coordinates 1955113..1955370 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A0K2E7Z9
Locus tag QNH74_RS09545 Protein ID WP_002939010.1
Coordinates 1955372..1955632 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNH74_RS09520 1950834..1952564 - 1731 WP_024387386.1 membrane protein -
QNH74_RS09525 1953025..1953498 - 474 WP_024378560.1 IS200/IS605 family transposase -
QNH74_RS09530 1953678..1954550 - 873 WP_024387385.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QNH74_RS09535 1954569..1955099 - 531 WP_074390182.1 DUF1697 domain-containing protein -
QNH74_RS09540 1955113..1955370 - 258 WP_012775363.1 Txe/YoeB family addiction module toxin Toxin
QNH74_RS09545 1955372..1955632 - 261 WP_002939010.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QNH74_RS09550 1955708..1956163 - 456 WP_074390181.1 8-oxo-dGTP diphosphatase -
QNH74_RS09555 1956170..1956499 - 330 WP_012775364.1 type II toxin-antitoxin system RelE/ParE family toxin -
QNH74_RS09560 1956489..1956776 - 288 WP_012028535.1 hypothetical protein -
QNH74_RS09565 1956874..1957242 - 369 WP_012775453.1 hypothetical protein -
QNH74_RS09570 1957235..1957804 - 570 WP_012775700.1 ribonuclease M5 -
QNH74_RS09575 1957788..1958570 - 783 WP_012028536.1 TatD family hydrolase -
QNH74_RS09580 1958677..1958814 - 138 WP_002939016.1 50S ribosomal protein L34 -
QNH74_RS09585 1958982..1959977 - 996 WP_012775367.1 RNA-binding cell elongation regulator Jag/EloR -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1931690..1958570 26880
- flank IS/Tn - - 1953025..1953498 473


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(1-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10346.81 Da        Isoelectric Point: 7.2737

>T296649 WP_012775363.1 NZ_OX352806:c1955370-1955113 [Streptococcus suis]
MGIHFTDDAWEDYLYWQGQDKKTLKRINKIIQDMQRHPFEGIAKPEPLKYDYQGAWSRRIDAENRLIYMVEADRLCILSL
KDHYR

Download         Length: 258 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9980.36 Da        Isoelectric Point: 5.7134

>AT296649 WP_002939010.1 NZ_OX352806:c1955632-1955372 [Streptococcus suis]
MEAIVYSHFRNHLKDYMKKVNDEFEPLVVVNKNPEEDIVVLSKSEWDSLQETLAVARNTYLSQKVLRGMAKVKTGQTQER
NLIEAD

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2K1SXY6

Antitoxin

Source ID Structure
AlphaFold DB A0A0K2E7Z9

References