Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1466271..1466857 | Replicon | chromosome |
| Accession | NZ_OX352324 | ||
| Organism | Pseudomonas sp. MM221 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | OM991_RS06810 | Protein ID | WP_264362023.1 |
| Coordinates | 1466579..1466857 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | OM991_RS06805 | Protein ID | WP_264362022.1 |
| Coordinates | 1466271..1466570 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OM991_RS06780 (GLGCALEP_01416) | 1462198..1463007 | + | 810 | WP_264362018.1 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA | - |
| OM991_RS06785 (GLGCALEP_01417) | 1463040..1463450 | - | 411 | WP_264362019.1 | SufE family protein | - |
| OM991_RS06790 (GLGCALEP_01418) | 1463447..1464652 | - | 1206 | WP_264362020.1 | cysteine desulfurase | - |
| OM991_RS06795 (GLGCALEP_01419) | 1464734..1465768 | - | 1035 | WP_264362021.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
| OM991_RS06800 (GLGCALEP_01421) | 1465800..1466146 | - | 347 | Protein_1324 | ArsC family reductase | - |
| OM991_RS06805 (GLGCALEP_01422) | 1466271..1466570 | - | 300 | WP_264362022.1 | type II toxin-antitoxin system antitoxin GraA | Antitoxin |
| OM991_RS06810 | 1466579..1466857 | - | 279 | WP_264362023.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OM991_RS06815 (GLGCALEP_01423) | 1467110..1468756 | + | 1647 | WP_264362024.1 | Na+/H+ antiporter | - |
| OM991_RS06820 (GLGCALEP_01424) | 1468862..1470058 | - | 1197 | WP_264362025.1 | succinyldiaminopimelate transaminase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10460.90 Da Isoelectric Point: 9.4173
>T296636 WP_264362023.1 NZ_OX352324:c1466857-1466579 [Pseudomonas sp. MM221]
MIRSFSCAETEALFCTGKTRRWSDIKSVAERKLAMLDAATALRDLRSPPGNRLESLSGNRAGQHSIRVNDQWRVCFTWTE
HGPVNVKIVDYH
MIRSFSCAETEALFCTGKTRRWSDIKSVAERKLAMLDAATALRDLRSPPGNRLESLSGNRAGQHSIRVNDQWRVCFTWTE
HGPVNVKIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|