Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 5683263..5684053 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | - |
Locus tag | ONI07_RS26420 | Protein ID | WP_264360720.1 |
Coordinates | 5683586..5684053 (+) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | ONI07_RS26415 | Protein ID | WP_014859917.1 |
Coordinates | 5683263..5683589 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS26395 (DBADOPDK_05389) | 5678862..5679923 | - | 1062 | WP_264360716.1 | HlyD family secretion protein | - |
ONI07_RS26400 (DBADOPDK_05390) | 5679952..5681493 | - | 1542 | WP_264360717.1 | MFS transporter | - |
ONI07_RS26405 | 5681608..5682515 | - | 908 | Protein_5189 | LysR family transcriptional regulator | - |
ONI07_RS26410 (DBADOPDK_05393) | 5682725..5683171 | + | 447 | WP_264360718.1 | universal stress protein | - |
ONI07_RS26415 (DBADOPDK_05394) | 5683263..5683589 | + | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
ONI07_RS26420 (DBADOPDK_05395) | 5683586..5684053 | + | 468 | WP_264360720.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
ONI07_RS26425 (DBADOPDK_05396) | 5684103..5684963 | - | 861 | WP_264360721.1 | HlyD family secretion protein | - |
ONI07_RS26430 (DBADOPDK_05397) | 5684974..5685174 | - | 201 | WP_008097766.1 | DUF1656 domain-containing protein | - |
ONI07_RS26435 (DBADOPDK_05398) | 5685164..5687341 | - | 2178 | WP_264387208.1 | FUSC family protein | - |
ONI07_RS26440 (DBADOPDK_05399) | 5687338..5688867 | - | 1530 | WP_264360722.1 | efflux transporter outer membrane subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17954.42 Da Isoelectric Point: 9.9065
>T296632 WP_264360720.1 NZ_OX352322:5683586-5684053 [Pseudomonas sp. MM223]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVQAQMHKDPTGYTSRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVQAQMHKDPTGYTSRNAYKRLAAIKRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWVNDESSKRAYESSDDAYKVFQKMLHTGHPPDDWEQLLREAAAE
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|