Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4741681..4742381 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | ONI07_RS22075 | Protein ID | WP_264360167.1 |
Coordinates | 4742085..4742381 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | - |
Locus tag | ONI07_RS22070 | Protein ID | WP_264360166.1 |
Coordinates | 4741681..4742082 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS22050 (DBADOPDK_04499) | 4736818..4737639 | - | 822 | WP_264360163.1 | transporter substrate-binding domain-containing protein | - |
ONI07_RS22055 (DBADOPDK_04500) | 4737715..4738644 | - | 930 | WP_264360164.1 | FAD-binding protein | - |
ONI07_RS22060 (DBADOPDK_04501) | 4738645..4739394 | - | 750 | WP_016498683.1 | electron transfer flavoprotein subunit beta/FixA family protein | - |
ONI07_RS22065 (DBADOPDK_04502) | 4739945..4741609 | + | 1665 | WP_264360165.1 | electron transfer flavoprotein-ubiquinone oxidoreductase | - |
ONI07_RS22070 (DBADOPDK_04503) | 4741681..4742082 | - | 402 | WP_264360166.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
ONI07_RS22075 (DBADOPDK_04504) | 4742085..4742381 | - | 297 | WP_264360167.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
ONI07_RS22080 (DBADOPDK_04505) | 4742475..4743800 | - | 1326 | WP_264360168.1 | MFS transporter | - |
ONI07_RS22085 (DBADOPDK_04506) | 4743873..4744352 | - | 480 | WP_264360169.1 | histidine kinase | - |
ONI07_RS22090 (DBADOPDK_04507) | 4744521..4744997 | - | 477 | WP_264360170.1 | sigma-70 family RNA polymerase sigma factor | - |
ONI07_RS22095 (DBADOPDK_04508) | 4745217..4746389 | + | 1173 | WP_264360171.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11054.99 Da Isoelectric Point: 9.4795
>T296629 WP_264360167.1 NZ_OX352322:c4742381-4742085 [Pseudomonas sp. MM223]
MEKRTPHCPLERVRALAAARCIRPTGAALRGAKALGMDYPGMLEVISSLERTDFYKSMTSHMDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKGL
MEKRTPHCPLERVRALAAARCIRPTGAALRGAKALGMDYPGMLEVISSLERTDFYKSMTSHMDHRVWQDVYRPLTAIGYV
YLKLSVVDDVLIVSFKGL
Download Length: 297 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14541.62 Da Isoelectric Point: 4.9438
>AT296629 WP_264360166.1 NZ_OX352322:c4742082-4741681 [Pseudomonas sp. MM223]
MKCPICGGAELAPDVQGMPFSYKGEATVIPDVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNATVVDPSFIASMRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
MKCPICGGAELAPDVQGMPFSYKGEATVIPDVSGDYCSACGECVLSHDEAMRVSHLMTAFERQVNATVVDPSFIASMRRK
FDLDQREAGEIFGGGVNAFSRYENGKTTPPVALVKLLKLLDRHPELFEEVRTA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|