Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1466627..1467213 | Replicon | chromosome |
Accession | NZ_OX352322 | ||
Organism | Pseudomonas sp. MM223 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | ONI07_RS06765 | Protein ID | WP_264362023.1 |
Coordinates | 1466935..1467213 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | ONI07_RS06760 | Protein ID | WP_264362022.1 |
Coordinates | 1466627..1466926 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ONI07_RS06735 (DBADOPDK_01382) | 1462553..1463362 | + | 810 | WP_264362018.1 | tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA | - |
ONI07_RS06740 (DBADOPDK_01383) | 1463395..1463805 | - | 411 | WP_264362019.1 | SufE family protein | - |
ONI07_RS06745 (DBADOPDK_01384) | 1463802..1465007 | - | 1206 | WP_264362020.1 | cysteine desulfurase | - |
ONI07_RS06750 (DBADOPDK_01385) | 1465089..1466123 | - | 1035 | WP_264362021.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
ONI07_RS06755 (DBADOPDK_01386) | 1466155..1466502 | - | 348 | WP_003252272.1 | ArsC family reductase | - |
ONI07_RS06760 (DBADOPDK_01387) | 1466627..1466926 | - | 300 | WP_264362022.1 | type II toxin-antitoxin system antitoxin GraA | Antitoxin |
ONI07_RS06765 | 1466935..1467213 | - | 279 | WP_264362023.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
ONI07_RS06770 (DBADOPDK_01388) | 1467466..1469113 | + | 1648 | Protein_1318 | Na+/H+ antiporter | - |
ONI07_RS06775 (DBADOPDK_01389) | 1469219..1470415 | - | 1197 | WP_264362025.1 | succinyldiaminopimelate transaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10460.90 Da Isoelectric Point: 9.4173
>T296626 WP_264362023.1 NZ_OX352322:c1467213-1466935 [Pseudomonas sp. MM223]
MIRSFSCAETEALFCTGKTRRWSDIKSVAERKLAMLDAATALRDLRSPPGNRLESLSGNRAGQHSIRVNDQWRVCFTWTE
HGPVNVKIVDYH
MIRSFSCAETEALFCTGKTRRWSDIKSVAERKLAMLDAATALRDLRSPPGNRLESLSGNRAGQHSIRVNDQWRVCFTWTE
HGPVNVKIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|