Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4503285..4503859 | Replicon | chromosome |
Accession | NZ_OX352320 | ||
Organism | Rheinheimera sp. MM224 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OM978_RS20860 | Protein ID | WP_264346981.1 |
Coordinates | 4503581..4503859 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OM978_RS20855 | Protein ID | WP_264344344.1 |
Coordinates | 4503285..4503581 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OM978_RS20840 (JAMGFMIE_04190) | 4500011..4500631 | + | 621 | WP_264344341.1 | LysE family translocator | - |
OM978_RS20845 (JAMGFMIE_04191) | 4500897..4502438 | + | 1542 | WP_264344342.1 | alpha-L-arabinofuranosidase C-terminal domain-containing protein | - |
OM978_RS20850 (JAMGFMIE_04192) | 4502502..4502999 | - | 498 | WP_264344343.1 | DUF1993 domain-containing protein | - |
OM978_RS20855 (JAMGFMIE_04193) | 4503285..4503581 | - | 297 | WP_264344344.1 | HigA family addiction module antitoxin | Antitoxin |
OM978_RS20860 (JAMGFMIE_04194) | 4503581..4503859 | - | 279 | WP_264346981.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OM978_RS20865 (JAMGFMIE_04195) | 4504015..4504413 | + | 399 | WP_233010886.1 | BlaI/MecI/CopY family transcriptional regulator | - |
OM978_RS20870 (JAMGFMIE_04196) | 4504415..4505797 | + | 1383 | WP_264344345.1 | M23/M56 family metallopeptidase | - |
OM978_RS20875 (JAMGFMIE_04197) | 4505814..4506941 | + | 1128 | WP_264344346.1 | serine hydrolase domain-containing protein | - |
OM978_RS20880 (JAMGFMIE_04198) | 4506958..4507857 | + | 900 | WP_264344347.1 | alpha/beta hydrolase-fold protein | - |
OM978_RS20885 (JAMGFMIE_04199) | 4507919..4508347 | + | 429 | WP_264344348.1 | nucleotidyltransferase substrate binding protein | - |
OM978_RS20890 (JAMGFMIE_04200) | 4508340..4508642 | + | 303 | WP_264344349.1 | nucleotidyltransferase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10673.14 Da Isoelectric Point: 9.9127
>T296624 WP_264346981.1 NZ_OX352320:c4503859-4503581 [Rheinheimera sp. MM224]
MIKNFKHKGLERFYKTGSTAGIKAKHQNRLRLILSNLDQAEAIDDMDLPGLRLHELSGDRKGIWSVTVNGNWRVTFRFVG
RDAEIVNYEDYH
MIKNFKHKGLERFYKTGSTAGIKAKHQNRLRLILSNLDQAEAIDDMDLPGLRLHELSGDRKGIWSVTVNGNWRVTFRFVG
RDAEIVNYEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|