Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2763353..2763632 | Replicon | chromosome |
Accession | NZ_OX344719 | ||
Organism | Staphylococcus aureus strain ST20190863 isolate ST20190863 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | OOL12_RS13915 | Protein ID | WP_001802298.1 |
Coordinates | 2763353..2763457 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2763453..2763632 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOL12_RS13885 | 2758737..2759519 | + | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
OOL12_RS13890 | 2759587..2760444 | + | 858 | WP_000370924.1 | HAD family hydrolase | - |
OOL12_RS13895 | 2760676..2760860 | - | 185 | Protein_2701 | exotoxin | - |
OOL12_RS13900 | 2761149..2761241 | - | 93 | WP_001790138.1 | hypothetical protein | - |
OOL12_RS13905 | 2761530..2762666 | + | 1137 | WP_264717378.1 | SAP domain-containing protein | - |
OOL12_RS13910 | 2762709..2763192 | + | 484 | Protein_2704 | recombinase family protein | - |
OOL12_RS13915 | 2763353..2763457 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 2763453..2763632 | - | 180 | - | - | Antitoxin |
OOL12_RS13925 | 2763957..2765048 | - | 1092 | WP_000495671.1 | lytic regulatory protein | - |
OOL12_RS13930 | 2765314..2766294 | - | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
OOL12_RS13935 | 2766296..2766616 | - | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
OOL12_RS13940 | 2766768..2767433 | + | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
OOL12_RS13945 | 2767868..2768569 | + | 702 | WP_264717379.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T296609 WP_001802298.1 NZ_OX344719:2763353-2763457 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
Antitoxin
Download Length: 180 bp
>AT296609 NZ_OX344719:c2763632-2763453 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCATTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|