Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 180459..180641 | Replicon | chromosome |
| Accession | NZ_OX344719 | ||
| Organism | Staphylococcus aureus strain ST20190863 isolate ST20190863 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | OOL12_RS01090 | Protein ID | WP_001801861.1 |
| Coordinates | 180546..180641 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 180459..180518 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOL12_RS01075 | 179597..179974 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| OOL12_RS01080 | 180168..180344 | + | 177 | Protein_176 | transposase | - |
| OOL12_RS01085 | 180322..180423 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 180459..180518 | + | 60 | - | - | Antitoxin |
| OOL12_RS01090 | 180546..180641 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| OOL12_RS01095 | 180844..180987 | + | 144 | WP_001549059.1 | transposase | - |
| OOL12_RS01100 | 181591..181974 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| OOL12_RS01105 | 181985..182161 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| OOL12_RS01110 | 182163..182348 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| OOL12_RS01115 | 182462..183103 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| OOL12_RS01120 | 183321..183872 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| OOL12_RS01125 | 183970..184314 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| OOL12_RS01130 | 184355..184981 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T296601 WP_001801861.1 NZ_OX344719:c180641-180546 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
Antitoxin
Download Length: 60 bp
>AT296601 NZ_OX344719:180459-180518 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|