Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324022..324608 Replicon chromosome
Accession NZ_OX337252
Organism Klebsiella pneumoniae isolate 65326252-51f1-11ec-980a-fa163eea3084

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag OGZ45_RS01515 Protein ID WP_002920800.1
Coordinates 324240..324608 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag OGZ45_RS01510 Protein ID WP_004174006.1
Coordinates 324022..324243 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGZ45_RS01490 320179..321105 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
OGZ45_RS01495 321102..322379 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
OGZ45_RS01500 322376..323143 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
OGZ45_RS01505 323145..323858 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
OGZ45_RS01510 324022..324243 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OGZ45_RS01515 324240..324608 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
OGZ45_RS01520 324881..326197 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
OGZ45_RS01525 326304..327191 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
OGZ45_RS01530 327188..328033 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
OGZ45_RS01535 328035..329105 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321102..329842 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296583 WP_002920800.1 NZ_OX337252:324240-324608 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT296583 WP_004174006.1 NZ_OX337252:324022-324243 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References