Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 49548..49817 Replicon plasmid P3
Accession NZ_OX030731
Organism Escherichia coli isolate 68

Toxin (Protein)


Gene name hok Uniprot ID G9G195
Locus tag LQ200_RS26755 Protein ID WP_001323520.1
Coordinates 49701..49817 (+) Length 39 a.a.

Antitoxin (RNA)


Gene name sok
Locus tag -
Coordinates 49548..49613 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ200_RS26725 (45918) 45918..46151 + 234 WP_000006030.1 DUF905 family protein -
LQ200_RS26730 (46216) 46216..48174 + 1959 WP_000117213.1 ParB/RepB/Spo0J family partition protein -
LQ200_RS26735 (48229) 48229..48663 + 435 WP_000845910.1 conjugation system SOS inhibitor PsiB -
LQ200_RS26740 (48660) 48660..49422 + 763 Protein_50 plasmid SOS inhibition protein A -
LQ200_RS26745 (49391) 49391..49579 - 189 WP_001336239.1 hypothetical protein -
- (49548) 49548..49613 + 66 NuclAT_1 - -
- (49548) 49548..49613 - 66 NuclAT_0 - Antitoxin
- (49391) 49391..49615 + 225 NuclAT_0 - -
- (49391) 49391..49615 + 225 NuclAT_0 - -
- (49391) 49391..49615 + 225 NuclAT_0 - -
- (49391) 49391..49615 + 225 NuclAT_0 - -
- (49391) 49391..49615 - 225 NuclAT_0 - -
LQ200_RS26750 (49601) 49601..49750 + 150 Protein_52 plasmid maintenance protein Mok -
LQ200_RS26755 (49701) 49701..49817 + 117 WP_001323520.1 type I toxin-antitoxin system Hok family toxin Toxin
LQ200_RS26760 (50218) 50218..51885 - 1668 WP_001091723.1 group II intron reverse transcriptase/maturase -
LQ200_RS26765 (52614) 52614..52787 - 174 Protein_55 hypothetical protein -
LQ200_RS26770 (53087) 53087..53374 + 288 WP_000107526.1 hypothetical protein -
LQ200_RS26775 (53493) 53493..54314 + 822 WP_230139597.1 DUF932 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(1-34)


Sequences

Toxin        


Download         Length: 39 a.a.        Molecular weight: 4455.23 Da        Isoelectric Point: 8.5110

>T296571 WP_001323520.1 NZ_OX030731:49701-49817 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Download         Length: 117 bp

Antitoxin


Download         Length: 66 bp

>AT296571 NZ_OX030731:c49613-49548 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G9G195

Antitoxin

Download structure file

References