Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49391..49817 | Replicon | plasmid P3 |
| Accession | NZ_OX030731 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | G9G195 |
| Locus tag | LQ200_RS26755 | Protein ID | WP_001323520.1 |
| Coordinates | 49701..49817 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 49391..49615 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS26720 (44525) | 44525..45645 | + | 1121 | WP_085949406.1 | IS3-like element ISSen4 family transposase | - |
| LQ200_RS26725 (45918) | 45918..46151 | + | 234 | WP_000006030.1 | DUF905 family protein | - |
| LQ200_RS26730 (46216) | 46216..48174 | + | 1959 | WP_000117213.1 | ParB/RepB/Spo0J family partition protein | - |
| LQ200_RS26735 (48229) | 48229..48663 | + | 435 | WP_000845910.1 | conjugation system SOS inhibitor PsiB | - |
| LQ200_RS26740 (48660) | 48660..49422 | + | 763 | Protein_50 | plasmid SOS inhibition protein A | - |
| LQ200_RS26745 (49391) | 49391..49579 | - | 189 | WP_001336239.1 | hypothetical protein | - |
| - (49548) | 49548..49613 | + | 66 | NuclAT_1 | - | - |
| - (49548) | 49548..49613 | - | 66 | NuclAT_0 | - | - |
| - (49391) | 49391..49615 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49391) | 49391..49615 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49391) | 49391..49615 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49391) | 49391..49615 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (49391) | 49391..49615 | - | 225 | NuclAT_0 | - | - |
| LQ200_RS26750 (49601) | 49601..49750 | + | 150 | Protein_52 | plasmid maintenance protein Mok | - |
| LQ200_RS26755 (49701) | 49701..49817 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LQ200_RS26760 (50218) | 50218..51885 | - | 1668 | WP_001091723.1 | group II intron reverse transcriptase/maturase | - |
| LQ200_RS26765 (52614) | 52614..52787 | - | 174 | Protein_55 | hypothetical protein | - |
| LQ200_RS26770 (53087) | 53087..53374 | + | 288 | WP_000107526.1 | hypothetical protein | - |
| LQ200_RS26775 (53493) | 53493..54314 | + | 822 | WP_230139597.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T296570 WP_001323520.1 NZ_OX030731:49701-49817 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 225 bp
>AT296570 NZ_OX030731:49391-49615 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGTCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|