Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33824..34063 | Replicon | plasmid P1 |
| Accession | NZ_OX030729 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | LQ200_RS25505 | Protein ID | WP_023144756.1 |
| Coordinates | 33824..33958 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 34003..34063 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS25465 (29916) | 29916..30317 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| LQ200_RS25470 (30250) | 30250..30507 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| LQ200_RS25475 (30600) | 30600..31253 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| LQ200_RS25480 (31351) | 31351..31491 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| LQ200_RS25485 (32193) | 32193..32969 | - | 777 | WP_143359178.1 | plasmid replication initiator RepA | - |
| LQ200_RS25490 (32962) | 32962..33036 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| LQ200_RS25495 (33036) | 33036..33167 | - | 132 | Protein_44 | protein CopA/IncA | - |
| LQ200_RS25500 (33273) | 33273..33527 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| LQ200_RS25505 (33824) | 33824..33958 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (34003) | 34003..34063 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (34003) | 34003..34063 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (34003) | 34003..34063 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (34003) | 34003..34063 | + | 61 | NuclAT_0 | - | Antitoxin |
| LQ200_RS25510 (34030) | 34030..34316 | - | 287 | Protein_47 | DUF2726 domain-containing protein | - |
| LQ200_RS25515 (34829) | 34829..35041 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| LQ200_RS25520 (35172) | 35172..35732 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| LQ200_RS25525 (35787) | 35787..36533 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(3)-IId / erm(B) / mph(A) / sul1 / qacE / aadA5 / aac(6')-Ib-cr / blaOXA-1 / catB3 / blaTEM-1B | - | 1..115409 | 115409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T296562 WP_023144756.1 NZ_OX030729:c33958-33824 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT296562 NZ_OX030729:34003-34063 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
