Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4526125..4526819 | Replicon | chromosome |
Accession | NZ_OX030728 | ||
Organism | Escherichia coli isolate 68 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | V0YKG6 |
Locus tag | LQ200_RS21695 | Protein ID | WP_001263485.1 |
Coordinates | 4526421..4526819 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | LQ200_RS21690 | Protein ID | WP_000554758.1 |
Coordinates | 4526125..4526418 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ200_RS21670 (4521631) | 4521631..4522380 | + | 750 | WP_000093945.1 | C40 family peptidase | - |
LQ200_RS21675 (4522478) | 4522478..4524190 | - | 1713 | Protein_4235 | flagellar biosynthesis protein FlhA | - |
LQ200_RS21680 (4524162) | 4524162..4524947 | + | 786 | WP_000207541.1 | putative lateral flagellar export/assembly protein LafU | - |
LQ200_RS21685 (4525018) | 4525018..4526073 | + | 1056 | WP_001226177.1 | DNA polymerase IV | - |
LQ200_RS21690 (4526125) | 4526125..4526418 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
LQ200_RS21695 (4526421) | 4526421..4526819 | + | 399 | WP_001263485.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
LQ200_RS21700 (4526829) | 4526829..4527281 | + | 453 | WP_001059900.1 | GNAT family N-acetyltransferase | - |
LQ200_RS21705 (4527600) | 4527600..4528739 | + | 1140 | WP_000521554.1 | RNA ligase RtcB family protein | - |
LQ200_RS21710 (4528736) | 4528736..4529350 | + | 615 | WP_000602129.1 | peptide chain release factor H | - |
LQ200_RS21715 (4529412) | 4529412..4529921 | + | 510 | WP_000469793.1 | metal-dependent hydrolase | - |
LQ200_RS21720 (4529938) | 4529938..4530219 | - | 282 | WP_000106438.1 | hypothetical protein | - |
LQ200_RS21725 (4530228) | 4530228..4531685 | - | 1458 | WP_001293011.1 | cytosol nonspecific dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15418.84 Da Isoelectric Point: 7.3840
>T296558 WP_001263485.1 NZ_OX030728:4526421-4526819 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGILPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLCQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|