Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4257885..4258143 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | LQ200_RS20500 | Protein ID | WP_000809168.1 |
| Coordinates | 4257885..4258037 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4258086..4258143 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS20480 | 4253127..4253840 | - | 714 | WP_001102367.1 | acidic protein MsyB | - |
| LQ200_RS20485 | 4253866..4254270 | - | 405 | WP_000843582.1 | DUF2541 family protein | - |
| LQ200_RS20490 | 4254646..4256562 | + | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| LQ200_RS20495 | 4256651..4257781 | + | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| LQ200_RS20500 | 4257885..4258037 | - | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| - | 4258086..4258143 | + | 58 | - | - | Antitoxin |
| LQ200_RS20505 | 4258623..4259789 | + | 1167 | WP_000681352.1 | Na+/H+ antiporter NhaA | - |
| LQ200_RS20510 | 4259855..4260754 | + | 900 | WP_001300855.1 | transcriptional activator NhaR | - |
| LQ200_RS20515 | 4260792..4261751 | - | 960 | WP_000871677.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T296557 WP_000809168.1 NZ_OX030728:c4258037-4257885 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT296557 NZ_OX030728:4258086-4258143 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|