Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2711899..2712698 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | LQ200_RS13200 | Protein ID | WP_000347273.1 |
| Coordinates | 2712234..2712698 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V0YUB5 |
| Locus tag | LQ200_RS13195 | Protein ID | WP_001309780.1 |
| Coordinates | 2711899..2712234 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS13180 (2707684) | 2707684..2708454 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| LQ200_RS13185 (2708470) | 2708470..2709804 | - | 1335 | WP_000599654.1 | galactarate/glucarate/glycerate transporter GarP | - |
| LQ200_RS13190 (2710179) | 2710179..2711750 | + | 1572 | WP_181261139.1 | galactarate dehydratase | - |
| LQ200_RS13195 (2711899) | 2711899..2712234 | + | 336 | WP_001309780.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| LQ200_RS13200 (2712234) | 2712234..2712698 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| LQ200_RS13205 (2712753) | 2712753..2713562 | - | 810 | WP_000072171.1 | aga operon transcriptional regulator AgaR | - |
| LQ200_RS13210 (2713811) | 2713811..2715091 | + | 1281 | WP_000681959.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| LQ200_RS13215 (2715114) | 2715114..2715587 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| LQ200_RS13220 (2715598) | 2715598..2716377 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| LQ200_RS13225 (2716367) | 2716367..2717245 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| LQ200_RS13230 (2717263) | 2717263..2717697 | + | 435 | WP_000948818.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2702536..2712698 | 10162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T296551 WP_000347273.1 NZ_OX030728:2712234-2712698 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|