Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2114978..2115705 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | LQ200_RS10320 | Protein ID | WP_000547555.1 |
| Coordinates | 2115394..2115705 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ200_RS10315 | Protein ID | WP_000126294.1 |
| Coordinates | 2114978..2115397 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS10295 (2110063) | 2110063..2110590 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| LQ200_RS10300 (2110739) | 2110739..2111749 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| LQ200_RS10305 (2112009) | 2112009..2113466 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| LQ200_RS10310 (2113475) | 2113475..2114899 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| LQ200_RS10315 (2114978) | 2114978..2115397 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LQ200_RS10320 (2115394) | 2115394..2115705 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LQ200_RS10325 (2115872) | 2115872..2116342 | - | 471 | WP_000132967.1 | hydrogenase maturation peptidase HycI | - |
| LQ200_RS10330 (2116335) | 2116335..2116745 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| LQ200_RS10335 (2116742) | 2116742..2117509 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| LQ200_RS10340 (2117509) | 2117509..2118051 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| LQ200_RS10345 (2118061) | 2118061..2119770 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T296547 WP_000547555.1 NZ_OX030728:c2115705-2115394 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT296547 WP_000126294.1 NZ_OX030728:c2115397-2114978 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|