Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 384783..385004 | Replicon | chromosome |
| Accession | NZ_OX030728 | ||
| Organism | Escherichia coli isolate 68 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | LQ200_RS01980 | Protein ID | WP_000176713.1 |
| Coordinates | 384783..384890 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 384938..385004 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ200_RS01950 (379917) | 379917..380999 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| LQ200_RS01955 (380999) | 380999..381832 | + | 834 | WP_000456473.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| LQ200_RS01960 (381829) | 381829..382221 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| LQ200_RS01965 (382225) | 382225..383034 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| LQ200_RS01970 (383070) | 383070..383924 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| LQ200_RS01975 (384119) | 384119..384577 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| LQ200_RS01980 (384783) | 384783..384890 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (384940) | 384940..385003 | + | 64 | NuclAT_27 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_27 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_27 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_27 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_29 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_29 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_29 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_29 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_31 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_31 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_31 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_31 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_33 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_33 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_33 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_33 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_35 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_35 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_35 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_35 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_37 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_37 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_37 | - | - |
| - (384940) | 384940..385003 | + | 64 | NuclAT_37 | - | - |
| - (384938) | 384938..385004 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_15 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_17 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_19 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (384938) | 384938..385004 | + | 67 | NuclAT_23 | - | Antitoxin |
| - (384940) | 384940..385005 | + | 66 | NuclAT_39 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_39 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_39 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_39 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_41 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_41 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_41 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_41 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_43 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_43 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_43 | - | - |
| - (384940) | 384940..385005 | + | 66 | NuclAT_43 | - | - |
| LQ200_RS01985 (385318) | 385318..385425 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_26 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_26 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_26 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_26 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_28 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_28 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_28 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_28 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_30 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_30 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_30 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_30 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_32 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_32 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_32 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_32 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_34 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_34 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_34 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_34 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_36 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_36 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_36 | - | - |
| - (385478) | 385478..385539 | + | 62 | NuclAT_36 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_14 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_14 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_14 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_14 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_16 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_16 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_16 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_16 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_18 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_18 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_18 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_18 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_20 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_20 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_20 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_20 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_22 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_22 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_22 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_22 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_24 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_24 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_24 | - | - |
| - (385478) | 385478..385540 | + | 63 | NuclAT_24 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_38 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_38 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_38 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_38 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_40 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_40 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_40 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_40 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_42 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_42 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_42 | - | - |
| - (385478) | 385478..385541 | + | 64 | NuclAT_42 | - | - |
| LQ200_RS01990 (385831) | 385831..386931 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| LQ200_RS01995 (387201) | 387201..387431 | + | 231 | WP_001146450.1 | putative cation transport regulator ChaB | - |
| LQ200_RS02000 (387589) | 387589..388284 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| LQ200_RS02005 (388328) | 388328..388681 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 384119..384577 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T296537 WP_000176713.1 NZ_OX030728:c384890-384783 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT296537 NZ_OX030728:384938-385004 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|