Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 384783..385004 Replicon chromosome
Accession NZ_OX030728
Organism Escherichia coli isolate 68

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag LQ200_RS01980 Protein ID WP_000176713.1
Coordinates 384783..384890 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 384938..385004 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ200_RS01950 (379917) 379917..380999 + 1083 WP_000804726.1 peptide chain release factor 1 -
LQ200_RS01955 (380999) 380999..381832 + 834 WP_000456473.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ200_RS01960 (381829) 381829..382221 + 393 WP_000200377.1 invasion regulator SirB2 -
LQ200_RS01965 (382225) 382225..383034 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ200_RS01970 (383070) 383070..383924 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ200_RS01975 (384119) 384119..384577 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
LQ200_RS01980 (384783) 384783..384890 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (384940) 384940..385003 + 64 NuclAT_27 - -
- (384940) 384940..385003 + 64 NuclAT_27 - -
- (384940) 384940..385003 + 64 NuclAT_27 - -
- (384940) 384940..385003 + 64 NuclAT_27 - -
- (384940) 384940..385003 + 64 NuclAT_29 - -
- (384940) 384940..385003 + 64 NuclAT_29 - -
- (384940) 384940..385003 + 64 NuclAT_29 - -
- (384940) 384940..385003 + 64 NuclAT_29 - -
- (384940) 384940..385003 + 64 NuclAT_31 - -
- (384940) 384940..385003 + 64 NuclAT_31 - -
- (384940) 384940..385003 + 64 NuclAT_31 - -
- (384940) 384940..385003 + 64 NuclAT_31 - -
- (384940) 384940..385003 + 64 NuclAT_33 - -
- (384940) 384940..385003 + 64 NuclAT_33 - -
- (384940) 384940..385003 + 64 NuclAT_33 - -
- (384940) 384940..385003 + 64 NuclAT_33 - -
- (384940) 384940..385003 + 64 NuclAT_35 - -
- (384940) 384940..385003 + 64 NuclAT_35 - -
- (384940) 384940..385003 + 64 NuclAT_35 - -
- (384940) 384940..385003 + 64 NuclAT_35 - -
- (384940) 384940..385003 + 64 NuclAT_37 - -
- (384940) 384940..385003 + 64 NuclAT_37 - -
- (384940) 384940..385003 + 64 NuclAT_37 - -
- (384940) 384940..385003 + 64 NuclAT_37 - -
- (384938) 384938..385004 + 67 NuclAT_13 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_13 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_13 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_13 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_15 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_15 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_15 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_15 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_17 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_17 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_17 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_17 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_19 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_19 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_19 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_19 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_21 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_21 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_21 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_21 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_23 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_23 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_23 - Antitoxin
- (384938) 384938..385004 + 67 NuclAT_23 - Antitoxin
- (384940) 384940..385005 + 66 NuclAT_39 - -
- (384940) 384940..385005 + 66 NuclAT_39 - -
- (384940) 384940..385005 + 66 NuclAT_39 - -
- (384940) 384940..385005 + 66 NuclAT_39 - -
- (384940) 384940..385005 + 66 NuclAT_41 - -
- (384940) 384940..385005 + 66 NuclAT_41 - -
- (384940) 384940..385005 + 66 NuclAT_41 - -
- (384940) 384940..385005 + 66 NuclAT_41 - -
- (384940) 384940..385005 + 66 NuclAT_43 - -
- (384940) 384940..385005 + 66 NuclAT_43 - -
- (384940) 384940..385005 + 66 NuclAT_43 - -
- (384940) 384940..385005 + 66 NuclAT_43 - -
LQ200_RS01985 (385318) 385318..385425 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (385478) 385478..385539 + 62 NuclAT_26 - -
- (385478) 385478..385539 + 62 NuclAT_26 - -
- (385478) 385478..385539 + 62 NuclAT_26 - -
- (385478) 385478..385539 + 62 NuclAT_26 - -
- (385478) 385478..385539 + 62 NuclAT_28 - -
- (385478) 385478..385539 + 62 NuclAT_28 - -
- (385478) 385478..385539 + 62 NuclAT_28 - -
- (385478) 385478..385539 + 62 NuclAT_28 - -
- (385478) 385478..385539 + 62 NuclAT_30 - -
- (385478) 385478..385539 + 62 NuclAT_30 - -
- (385478) 385478..385539 + 62 NuclAT_30 - -
- (385478) 385478..385539 + 62 NuclAT_30 - -
- (385478) 385478..385539 + 62 NuclAT_32 - -
- (385478) 385478..385539 + 62 NuclAT_32 - -
- (385478) 385478..385539 + 62 NuclAT_32 - -
- (385478) 385478..385539 + 62 NuclAT_32 - -
- (385478) 385478..385539 + 62 NuclAT_34 - -
- (385478) 385478..385539 + 62 NuclAT_34 - -
- (385478) 385478..385539 + 62 NuclAT_34 - -
- (385478) 385478..385539 + 62 NuclAT_34 - -
- (385478) 385478..385539 + 62 NuclAT_36 - -
- (385478) 385478..385539 + 62 NuclAT_36 - -
- (385478) 385478..385539 + 62 NuclAT_36 - -
- (385478) 385478..385539 + 62 NuclAT_36 - -
- (385478) 385478..385540 + 63 NuclAT_14 - -
- (385478) 385478..385540 + 63 NuclAT_14 - -
- (385478) 385478..385540 + 63 NuclAT_14 - -
- (385478) 385478..385540 + 63 NuclAT_14 - -
- (385478) 385478..385540 + 63 NuclAT_16 - -
- (385478) 385478..385540 + 63 NuclAT_16 - -
- (385478) 385478..385540 + 63 NuclAT_16 - -
- (385478) 385478..385540 + 63 NuclAT_16 - -
- (385478) 385478..385540 + 63 NuclAT_18 - -
- (385478) 385478..385540 + 63 NuclAT_18 - -
- (385478) 385478..385540 + 63 NuclAT_18 - -
- (385478) 385478..385540 + 63 NuclAT_18 - -
- (385478) 385478..385540 + 63 NuclAT_20 - -
- (385478) 385478..385540 + 63 NuclAT_20 - -
- (385478) 385478..385540 + 63 NuclAT_20 - -
- (385478) 385478..385540 + 63 NuclAT_20 - -
- (385478) 385478..385540 + 63 NuclAT_22 - -
- (385478) 385478..385540 + 63 NuclAT_22 - -
- (385478) 385478..385540 + 63 NuclAT_22 - -
- (385478) 385478..385540 + 63 NuclAT_22 - -
- (385478) 385478..385540 + 63 NuclAT_24 - -
- (385478) 385478..385540 + 63 NuclAT_24 - -
- (385478) 385478..385540 + 63 NuclAT_24 - -
- (385478) 385478..385540 + 63 NuclAT_24 - -
- (385478) 385478..385541 + 64 NuclAT_38 - -
- (385478) 385478..385541 + 64 NuclAT_38 - -
- (385478) 385478..385541 + 64 NuclAT_38 - -
- (385478) 385478..385541 + 64 NuclAT_38 - -
- (385478) 385478..385541 + 64 NuclAT_40 - -
- (385478) 385478..385541 + 64 NuclAT_40 - -
- (385478) 385478..385541 + 64 NuclAT_40 - -
- (385478) 385478..385541 + 64 NuclAT_40 - -
- (385478) 385478..385541 + 64 NuclAT_42 - -
- (385478) 385478..385541 + 64 NuclAT_42 - -
- (385478) 385478..385541 + 64 NuclAT_42 - -
- (385478) 385478..385541 + 64 NuclAT_42 - -
LQ200_RS01990 (385831) 385831..386931 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
LQ200_RS01995 (387201) 387201..387431 + 231 WP_001146450.1 putative cation transport regulator ChaB -
LQ200_RS02000 (387589) 387589..388284 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ200_RS02005 (388328) 388328..388681 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 384119..384577 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T296537 WP_000176713.1 NZ_OX030728:c384890-384783 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT296537 NZ_OX030728:384938-385004 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References