Detailed information of TA system TA296531

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 45101..45370
• Replicon: plasmid P1
• Accession: NZ_OX030702
• Organism: Escherichia coli isolate 131

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ128_RS25065
• Protein ID: WP_096937776.1
• Coordinates: 45245..45370 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	45101..45166 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ128_RS25025	40119..40568	-	450	Protein_45	hypothetical protein	-
LQ128_RS25030	40870..41397	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
LQ128_RS25035	41455..41688	+	234	WP_000006003.1	DUF905 family protein	-
LQ128_RS25040	41749..43713	+	1965	WP_230153758.1	ParB/RepB/Spo0J family partition protein	-
LQ128_RS25045	43782..44216	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
LQ128_RS25050	44213..44975	+	763	Protein_50	plasmid SOS inhibition protein A	-
-	44944..45168	+	225	NuclAT_0	-	-
-	44944..45168	+	225	NuclAT_0	-	-
-	44944..45168	+	225	NuclAT_0	-	-
-	44944..45168	+	225	NuclAT_0	-	-
LQ128_RS25055	44953..45132	-	180	WP_001309233.1	hypothetical protein	-
-	45101..45166	-	66	-	-	Antitoxin
LQ128_RS25060	45154..45303	+	150	Protein_52	plasmid maintenance protein Mok	-
LQ128_RS25065	45245..45370	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ128_RS25070	45688..45985	-	298	Protein_54	hypothetical protein	-
LQ128_RS25075	46285..46581	+	297	WP_001272251.1	hypothetical protein	-
LQ128_RS25080	46692..47513	+	822	WP_001234445.1	DUF932 domain-containing protein	-
LQ128_RS25085	47810..48319	-	510	WP_000759173.1	transglycosylase SLT domain-containing protein	-
LQ128_RS25090	48733..49116	+	384	WP_001151538.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ128_RS25095	49303..49992	+	690	WP_016239105.1	conjugal transfer transcriptional regulator TraJ	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaTEM-1B	-	1..90741	90741

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T296531 WP_096937776.1 NZ_OX030702:45245-45370 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT296531 NZ_OX030702:c45166-45101 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin