Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45101..45370 | Replicon | plasmid P1 |
| Accession | NZ_OX030702 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LQ128_RS25065 | Protein ID | WP_096937776.1 |
| Coordinates | 45245..45370 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 45101..45166 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS25025 | 40119..40568 | - | 450 | Protein_45 | hypothetical protein | - |
| LQ128_RS25030 | 40870..41397 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| LQ128_RS25035 | 41455..41688 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| LQ128_RS25040 | 41749..43713 | + | 1965 | WP_230153758.1 | ParB/RepB/Spo0J family partition protein | - |
| LQ128_RS25045 | 43782..44216 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| LQ128_RS25050 | 44213..44975 | + | 763 | Protein_50 | plasmid SOS inhibition protein A | - |
| - | 44944..45168 | + | 225 | NuclAT_0 | - | - |
| - | 44944..45168 | + | 225 | NuclAT_0 | - | - |
| - | 44944..45168 | + | 225 | NuclAT_0 | - | - |
| - | 44944..45168 | + | 225 | NuclAT_0 | - | - |
| LQ128_RS25055 | 44953..45132 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 45101..45166 | - | 66 | - | - | Antitoxin |
| LQ128_RS25060 | 45154..45303 | + | 150 | Protein_52 | plasmid maintenance protein Mok | - |
| LQ128_RS25065 | 45245..45370 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LQ128_RS25070 | 45688..45985 | - | 298 | Protein_54 | hypothetical protein | - |
| LQ128_RS25075 | 46285..46581 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| LQ128_RS25080 | 46692..47513 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| LQ128_RS25085 | 47810..48319 | - | 510 | WP_000759173.1 | transglycosylase SLT domain-containing protein | - |
| LQ128_RS25090 | 48733..49116 | + | 384 | WP_001151538.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| LQ128_RS25095 | 49303..49992 | + | 690 | WP_016239105.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..90741 | 90741 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T296531 WP_096937776.1 NZ_OX030702:45245-45370 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT296531 NZ_OX030702:c45166-45101 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|