296525

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4996774..4996995 Replicon chromosome
Accession NZ_OX030701
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag LQ128_RS24365 Protein ID WP_001531632.1
Coordinates 4996774..4996881 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4996929..4996995 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ128_RS24340 (4992618) 4992618..4993700 + 1083 WP_000804726.1 peptide chain release factor 1 -
LQ128_RS24345 (4993700) 4993700..4994533 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ128_RS24350 (4994530) 4994530..4994922 + 393 WP_000200375.1 invasion regulator SirB2 -
LQ128_RS24355 (4994926) 4994926..4995735 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ128_RS24360 (4995771) 4995771..4996625 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ128_RS24365 (4996774) 4996774..4996881 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4996931) 4996931..4996994 + 64 NuclAT_12 - -
- (4996931) 4996931..4996994 + 64 NuclAT_12 - -
- (4996931) 4996931..4996994 + 64 NuclAT_12 - -
- (4996931) 4996931..4996994 + 64 NuclAT_12 - -
- (4996931) 4996931..4996994 + 64 NuclAT_13 - -
- (4996931) 4996931..4996994 + 64 NuclAT_13 - -
- (4996931) 4996931..4996994 + 64 NuclAT_13 - -
- (4996931) 4996931..4996994 + 64 NuclAT_13 - -
- (4996931) 4996931..4996994 + 64 NuclAT_14 - -
- (4996931) 4996931..4996994 + 64 NuclAT_14 - -
- (4996931) 4996931..4996994 + 64 NuclAT_14 - -
- (4996931) 4996931..4996994 + 64 NuclAT_14 - -
- (4996931) 4996931..4996994 + 64 NuclAT_15 - -
- (4996931) 4996931..4996994 + 64 NuclAT_15 - -
- (4996931) 4996931..4996994 + 64 NuclAT_15 - -
- (4996931) 4996931..4996994 + 64 NuclAT_15 - -
- (4996931) 4996931..4996994 + 64 NuclAT_16 - -
- (4996931) 4996931..4996994 + 64 NuclAT_16 - -
- (4996931) 4996931..4996994 + 64 NuclAT_16 - -
- (4996931) 4996931..4996994 + 64 NuclAT_16 - -
- (4996931) 4996931..4996994 + 64 NuclAT_17 - -
- (4996931) 4996931..4996994 + 64 NuclAT_17 - -
- (4996931) 4996931..4996994 + 64 NuclAT_17 - -
- (4996931) 4996931..4996994 + 64 NuclAT_17 - -
- (4996929) 4996929..4996995 + 67 NuclAT_10 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_10 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_10 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_10 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_5 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_5 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_5 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_5 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_6 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_6 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_6 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_6 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_7 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_7 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_7 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_7 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_8 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_8 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_8 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_8 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_9 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_9 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_9 - Antitoxin
- (4996929) 4996929..4996995 + 67 NuclAT_9 - Antitoxin
- (4996931) 4996931..4996996 + 66 NuclAT_18 - -
- (4996931) 4996931..4996996 + 66 NuclAT_18 - -
- (4996931) 4996931..4996996 + 66 NuclAT_18 - -
- (4996931) 4996931..4996996 + 66 NuclAT_18 - -
- (4996931) 4996931..4996996 + 66 NuclAT_19 - -
- (4996931) 4996931..4996996 + 66 NuclAT_19 - -
- (4996931) 4996931..4996996 + 66 NuclAT_19 - -
- (4996931) 4996931..4996996 + 66 NuclAT_19 - -
- (4996931) 4996931..4996996 + 66 NuclAT_20 - -
- (4996931) 4996931..4996996 + 66 NuclAT_20 - -
- (4996931) 4996931..4996996 + 66 NuclAT_20 - -
- (4996931) 4996931..4996996 + 66 NuclAT_20 - -
- (4996931) 4996931..4996996 + 66 NuclAT_21 - -
- (4996931) 4996931..4996996 + 66 NuclAT_21 - -
- (4996931) 4996931..4996996 + 66 NuclAT_21 - -
- (4996931) 4996931..4996996 + 66 NuclAT_21 - -
- (4996931) 4996931..4996996 + 66 NuclAT_22 - -
- (4996931) 4996931..4996996 + 66 NuclAT_22 - -
- (4996931) 4996931..4996996 + 66 NuclAT_22 - -
- (4996931) 4996931..4996996 + 66 NuclAT_22 - -
- (4996931) 4996931..4996996 + 66 NuclAT_23 - -
- (4996931) 4996931..4996996 + 66 NuclAT_23 - -
- (4996931) 4996931..4996996 + 66 NuclAT_23 - -
- (4996931) 4996931..4996996 + 66 NuclAT_23 - -
LQ128_RS24370 (4997286) 4997286..4998386 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
LQ128_RS24375 (4998656) 4998656..4998895 + 240 WP_000120702.1 putative cation transport regulator ChaB -
LQ128_RS24380 (4999044) 4999044..4999739 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ128_RS24385 (4999783) 4999783..5000136 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
LQ128_RS24390 (5000321) 5000321..5001715 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T296525 WP_001531632.1 NZ_OX030701:c4996881-4996774 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT296525 NZ_OX030701:4996929-4996995 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References