Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4141036..4141715 | Replicon | chromosome |
| Accession | NZ_OX030701 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | LQ128_RS19955 | Protein ID | WP_000057523.1 |
| Coordinates | 4141036..4141338 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | LQ128_RS19960 | Protein ID | WP_000806442.1 |
| Coordinates | 4141374..4141715 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ128_RS19930 (4136412) | 4136412..4138064 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| LQ128_RS19935 (4138102) | 4138102..4138605 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| LQ128_RS19940 (4138602) | 4138602..4139402 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| LQ128_RS19945 (4139426) | 4139426..4139905 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| LQ128_RS19950 (4140109) | 4140109..4140903 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| LQ128_RS19955 (4141036) | 4141036..4141338 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ128_RS19960 (4141374) | 4141374..4141715 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| LQ128_RS19965 (4141773) | 4141773..4144277 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| LQ128_RS19970 (4144539) | 4144539..4145471 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T296524 WP_000057523.1 NZ_OX030701:4141036-4141338 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|