Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2892026..2892628 | Replicon | chromosome |
Accession | NZ_OX030701 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | LQ128_RS14015 | Protein ID | WP_000897302.1 |
Coordinates | 2892026..2892337 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | LQ128_RS14020 | Protein ID | WP_000356397.1 |
Coordinates | 2892338..2892628 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ128_RS13990 (2887940) | 2887940..2888539 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
LQ128_RS13995 (2888533) | 2888533..2889405 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
LQ128_RS14000 (2889402) | 2889402..2889839 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
LQ128_RS14005 (2889884) | 2889884..2890825 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
LQ128_RS14010 (2890889) | 2890889..2891797 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
LQ128_RS14015 (2892026) | 2892026..2892337 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
LQ128_RS14020 (2892338) | 2892338..2892628 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
LQ128_RS14025 (2892987) | 2892987..2893265 | + | 279 | WP_001296612.1 | hypothetical protein | - |
LQ128_RS14030 (2893662) | 2893662..2893880 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
LQ128_RS14035 (2894065) | 2894065..2894805 | - | 741 | WP_000608806.1 | hypothetical protein | - |
LQ128_RS14040 (2894830) | 2894830..2895678 | - | 849 | WP_001038650.1 | hypothetical protein | - |
LQ128_RS14045 (2895968) | 2895968..2896210 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
LQ128_RS14050 (2896392) | 2896392..2897321 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T296516 WP_000897302.1 NZ_OX030701:2892026-2892337 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|