Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2080578..2081377 | Replicon | chromosome |
Accession | NZ_OX030701 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | LQ128_RS10050 | Protein ID | WP_000347251.1 |
Coordinates | 2080913..2081377 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | LQ128_RS10045 | Protein ID | WP_001296435.1 |
Coordinates | 2080578..2080913 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ128_RS10030 (2076363) | 2076363..2077133 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
LQ128_RS10035 (2077149) | 2077149..2078483 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ128_RS10040 (2078858) | 2078858..2080429 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
LQ128_RS10045 (2080578) | 2080578..2080913 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ128_RS10050 (2080913) | 2080913..2081377 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ128_RS10055 (2081432) | 2081432..2082241 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ128_RS10060 (2082490) | 2082490..2083770 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ128_RS10065 (2083793) | 2083793..2084266 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ128_RS10070 (2084277) | 2084277..2085056 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ128_RS10075 (2085046) | 2085046..2085924 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ128_RS10080 (2085942) | 2085942..2086376 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T296514 WP_000347251.1 NZ_OX030701:2080913-2081377 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |