Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1146781..1147367 Replicon chromosome
Accession NZ_OW970560
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LQV17_RS05695 Protein ID WP_002920800.1
Coordinates 1146781..1147149 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag LQV17_RS05700 Protein ID WP_004174006.1
Coordinates 1147146..1147367 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV17_RS05675 (1142284) 1142284..1143354 - 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -
LQV17_RS05680 (1143356) 1143356..1144201 - 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQV17_RS05685 (1144198) 1144198..1145085 - 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQV17_RS05690 (1145192) 1145192..1146508 - 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQV17_RS05695 (1146781) 1146781..1147149 - 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQV17_RS05700 (1147146) 1147146..1147367 - 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQV17_RS05705 (1147531) 1147531..1148244 - 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQV17_RS05710 (1148246) 1148246..1149013 - 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQV17_RS05715 (1149010) 1149010..1150287 - 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
LQV17_RS05720 (1150284) 1150284..1151210 - 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1141547..1150287 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296490 WP_002920800.1 NZ_OW970560:c1147149-1146781 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT296490 WP_004174006.1 NZ_OW970560:c1147367-1147146 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References