Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1120534..1121180 | Replicon | chromosome |
| Accession | NZ_OW970560 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4S7KZ03 |
| Locus tag | LQV17_RS05585 | Protein ID | WP_032433636.1 |
| Coordinates | 1120833..1121180 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4S7L580 |
| Locus tag | LQV17_RS05580 | Protein ID | WP_019725405.1 |
| Coordinates | 1120534..1120833 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV17_RS05560 (1116637) | 1116637..1117977 | + | 1341 | WP_023158721.1 | glucarate dehydratase | - |
| LQV17_RS05565 (1118050) | 1118050..1119189 | + | 1140 | WP_032433495.1 | glycerate kinase | - |
| LQV17_RS05570 (1119347) | 1119347..1120156 | - | 810 | Protein_1093 | response regulator | - |
| LQV17_RS05575 (1120160) | 1120160..1120471 | + | 312 | Protein_1094 | glycerol-3-phosphate dehydrogenase C-terminal domain-containing protein | - |
| LQV17_RS05580 (1120534) | 1120534..1120833 | - | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
| LQV17_RS05585 (1120833) | 1120833..1121180 | - | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQV17_RS05590 (1121356) | 1121356..1123803 | - | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
| LQV17_RS05595 (1123821) | 1123821..1125254 | - | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T296489 WP_032433636.1 NZ_OW970560:c1121180-1120833 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7KZ03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7L580 |