Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 356941..357587 | Replicon | chromosome |
Accession | NZ_OW970530 | ||
Organism | Klebsiella pneumoniae isolate 147 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A4S7KZ03 |
Locus tag | LQV07_RS01635 | Protein ID | WP_032433636.1 |
Coordinates | 356941..357288 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A4S7L580 |
Locus tag | LQV07_RS01640 | Protein ID | WP_019725405.1 |
Coordinates | 357288..357587 (+) | Length | 100 a.a. |
Genomic Context
Location: 352867..354300 (1434 bp)
Type: Others
Protein ID: WP_032433640.1
Type: Others
Protein ID: WP_032433640.1
Location: 354318..356765 (2448 bp)
Type: Others
Protein ID: WP_032433638.1
Type: Others
Protein ID: WP_032433638.1
Location: 356941..357288 (348 bp)
Type: Toxin
Protein ID: WP_032433636.1
Type: Toxin
Protein ID: WP_032433636.1
Location: 357288..357587 (300 bp)
Type: Antitoxin
Protein ID: WP_019725405.1
Type: Antitoxin
Protein ID: WP_019725405.1
Location: 359363..359692 (330 bp)
Type: Others
Protein ID: WP_002920552.1
Type: Others
Protein ID: WP_002920552.1
Location: 359743..360573 (831 bp)
Type: Others
Protein ID: WP_004151408.1
Type: Others
Protein ID: WP_004151408.1
Location: 360623..361381 (759 bp)
Type: Others
Protein ID: WP_002920548.1
Type: Others
Protein ID: WP_002920548.1
Location: 357650..359158 (1509 bp)
Type: Others
Protein ID: WP_029602548.1
Type: Others
Protein ID: WP_029602548.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV07_RS01625 (352867) | 352867..354300 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
LQV07_RS01630 (354318) | 354318..356765 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
LQV07_RS01635 (356941) | 356941..357288 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQV07_RS01640 (357288) | 357288..357587 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
LQV07_RS01645 (357650) | 357650..359158 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
LQV07_RS01650 (359363) | 359363..359692 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
LQV07_RS01655 (359743) | 359743..360573 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
LQV07_RS01660 (360623) | 360623..361381 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T296435 WP_032433636.1 NZ_OW970530:356941-357288 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7KZ03 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S7L580 |