Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 356941..357587 | Replicon | chromosome |
| Accession | NZ_OW970486 | ||
| Organism | Klebsiella pneumoniae isolate 147 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4S7KZ03 |
| Locus tag | LQV31_RS01635 | Protein ID | WP_032433636.1 |
| Coordinates | 356941..357288 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4S7L580 |
| Locus tag | LQV31_RS01640 | Protein ID | WP_019725405.1 |
| Coordinates | 357288..357587 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQV31_RS01625 (352867) | 352867..354300 | + | 1434 | WP_032433640.1 | glycogen synthase GlgA | - |
| LQV31_RS01630 (354318) | 354318..356765 | + | 2448 | WP_032433638.1 | glycogen phosphorylase | - |
| LQV31_RS01635 (356941) | 356941..357288 | + | 348 | WP_032433636.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQV31_RS01640 (357288) | 357288..357587 | + | 300 | WP_019725405.1 | XRE family transcriptional regulator | Antitoxin |
| LQV31_RS01645 (357650) | 357650..359158 | - | 1509 | WP_029602548.1 | glycerol-3-phosphate dehydrogenase | - |
| LQV31_RS01650 (359363) | 359363..359692 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| LQV31_RS01655 (359743) | 359743..360573 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| LQV31_RS01660 (360623) | 360623..361381 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13500.51 Da Isoelectric Point: 6.2327
>T296387 WP_032433636.1 NZ_OW970486:356941-357288 [Klebsiella pneumoniae]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGNKDGINEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7KZ03 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S7L580 |