Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324635..325221 Replicon chromosome
Accession NZ_OW970444
Organism Klebsiella pneumoniae isolate 101

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LQV08_RS01510 Protein ID WP_002920800.1
Coordinates 324853..325221 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag LQV08_RS01505 Protein ID WP_004174006.1
Coordinates 324635..324856 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV08_RS01485 (320792) 320792..321718 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LQV08_RS01490 (321715) 321715..322992 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
LQV08_RS01495 (322989) 322989..323756 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQV08_RS01500 (323758) 323758..324471 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQV08_RS01505 (324635) 324635..324856 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQV08_RS01510 (324853) 324853..325221 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQV08_RS01515 (325494) 325494..326810 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQV08_RS01520 (326917) 326917..327804 + 888 WP_032418302.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQV08_RS01525 (327801) 327801..328646 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQV08_RS01530 (328648) 328648..329718 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321715..330799 9084


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296337 WP_002920800.1 NZ_OW970444:324853-325221 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT296337 WP_004174006.1 NZ_OW970444:324635-324856 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References