Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 330630..331216 Replicon chromosome
Accession NZ_OW970436
Organism Klebsiella pneumoniae isolate 147

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag LQV41_RS01525 Protein ID WP_002920800.1
Coordinates 330848..331216 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag LQV41_RS01520 Protein ID WP_004174006.1
Coordinates 330630..330851 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQV41_RS01500 (326787) 326787..327713 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
LQV41_RS01505 (327710) 327710..328987 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
LQV41_RS01510 (328984) 328984..329751 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
LQV41_RS01515 (329753) 329753..330466 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
LQV41_RS01520 (330630) 330630..330851 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
LQV41_RS01525 (330848) 330848..331216 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
LQV41_RS01530 (331489) 331489..332805 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
LQV41_RS01535 (332912) 332912..333799 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
LQV41_RS01540 (333796) 333796..334641 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
LQV41_RS01545 (334643) 334643..335713 + 1071 WP_032433652.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 327710..336450 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T296320 WP_002920800.1 NZ_OW970436:330848-331216 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT296320 WP_004174006.1 NZ_OW970436:330630-330851 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References