Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4117121..4117766 | Replicon | chromosome |
Accession | NZ_OW970315 | ||
Organism | Pantoea agglomerans strain DAPP-PG734 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OOS96_RS19315 | Protein ID | WP_022625232.1 |
Coordinates | 4117413..4117766 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OOS96_RS19310 | Protein ID | WP_022625233.1 |
Coordinates | 4117121..4117420 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOS96_RS19295 (DAPPPG734_19590) | 4113034..4114818 | - | 1785 | WP_010252112.1 | GMC family oxidoreductase | - |
OOS96_RS19300 (DAPPPG734_19595) | 4114821..4115555 | - | 735 | WP_264704756.1 | gluconate 2-dehydrogenase subunit 3 family protein | - |
OOS96_RS19305 (DAPPPG734_19600) | 4115832..4117073 | + | 1242 | WP_010672044.1 | peptide antibiotic transporter SbmA | - |
OOS96_RS19310 (DAPPPG734_19605) | 4117121..4117420 | - | 300 | WP_022625233.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OOS96_RS19315 (DAPPPG734_19610) | 4117413..4117766 | - | 354 | WP_022625232.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OOS96_RS19320 (DAPPPG734_19615) | 4117976..4119028 | - | 1053 | WP_031591752.1 | YncE family protein | - |
OOS96_RS19325 (DAPPPG734_19620) | 4119231..4119440 | - | 210 | WP_009092571.1 | DUF1471 domain-containing protein | - |
OOS96_RS19330 (DAPPPG734_19625) | 4119653..4120840 | - | 1188 | WP_010252123.1 | MFS transporter | - |
OOS96_RS19335 (DAPPPG734_19630) | 4120945..4121910 | + | 966 | WP_031591753.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13407.28 Da Isoelectric Point: 6.4741
>T296234 WP_022625232.1 NZ_OW970315:c4117766-4117413 [Pantoea agglomerans]
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLARPFADTVDGSDFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
MWDVDTTKRFDEWFKAQSEELKEDMLAAIVILSEYGPHLARPFADTVDGSDFPNMKELRVQHQGKPIRAFFAFDPSRRGI
VLCAGDKTGVKEKKFYKDMIKLADAEFRKYLNGGDNG
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|