Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2014274..2014456 | Replicon | chromosome |
| Accession | NC_021670 | ||
| Organism | Staphylococcus aureus Bmb9393 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SABB_RS16420 | Protein ID | WP_001801861.1 |
| Coordinates | 2014274..2014369 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2014397..2014456 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SABB_RS10050 | 2009934..2010560 | + | 627 | WP_000669046.1 | hypothetical protein | - |
| SABB_RS10055 | 2010601..2010945 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
| SABB_RS10060 | 2011043..2011594 | + | 552 | WP_041205412.1 | hypothetical protein | - |
| SABB_RS10065 | 2011812..2012453 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SABB_RS10070 | 2012567..2012752 | - | 186 | WP_000809857.1 | hypothetical protein | - |
| SABB_RS10075 | 2012754..2012930 | - | 177 | WP_000375476.1 | hypothetical protein | - |
| SABB_RS10080 | 2012941..2013324 | - | 384 | WP_000070811.1 | hypothetical protein | - |
| SABB_RS10090 | 2013928..2014071 | - | 144 | WP_001549059.1 | transposase | - |
| SABB_RS16420 | 2014274..2014369 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2014397..2014456 | - | 60 | - | - | Antitoxin |
| SABB_RS10095 | 2014492..2014593 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| SABB_RS15890 | 2014571..2014747 | - | 177 | Protein_1964 | transposase | - |
| SABB_RS10100 | 2014941..2015318 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1987508..2046294 | 58786 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29623 WP_001801861.1 NC_021670:2014274-2014369 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29623 NC_021670:2014274-2014369 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT29623 NC_021670:c2014456-2014397 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|