Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 4012448..4013045 | Replicon | chromosome |
| Accession | NZ_OW969912 | ||
| Organism | Klebsiella variicola isolate 0 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0B7GEF2 |
| Locus tag | LQ196_RS19535 | Protein ID | WP_012542526.1 |
| Coordinates | 4012728..4013045 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ196_RS19530 | Protein ID | WP_012542525.1 |
| Coordinates | 4012448..4012735 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ196_RS19500 (AN2340V1_3745) | 4008358..4008606 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
| LQ196_RS19505 (AN2340V1_3746) | 4008623..4008964 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| LQ196_RS19510 (AN2340V1_3747) | 4008995..4010110 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
| LQ196_RS19515 (AN2340V1_3748) | 4010290..4010871 | + | 582 | WP_012968754.1 | TetR/AcrR family transcriptional regulator | - |
| LQ196_RS19520 (AN2340V1_3749) | 4010871..4011239 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
| LQ196_RS19525 (AN2340V1_3750) | 4011359..4012012 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| LQ196_RS19530 (AN2340V1_3751) | 4012448..4012735 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LQ196_RS19535 (AN2340V1_3752) | 4012728..4013045 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ196_RS19540 (AN2340V1_3753) | 4013230..4014273 | - | 1044 | WP_230138674.1 | DUF2157 domain-containing protein | - |
| LQ196_RS19545 (AN2340V1_3755) | 4014803..4015669 | - | 867 | WP_022065427.1 | helix-turn-helix transcriptional regulator | - |
| LQ196_RS19550 (AN2340V1_3756) | 4015778..4017205 | + | 1428 | WP_016160435.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T296224 WP_012542526.1 NZ_OW969912:c4013045-4012728 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|