Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 325546..326212 | Replicon | chromosome |
| Accession | NZ_OW969904 | ||
| Organism | Citrobacter freundii isolate 0 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A8B5Q945 |
| Locus tag | LQ142_RS01515 | Protein ID | WP_003847996.1 |
| Coordinates | 325895..326212 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A4U6IRD5 |
| Locus tag | LQ142_RS01510 | Protein ID | WP_003837894.1 |
| Coordinates | 325546..325842 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ142_RS01495 (322722) | 322722..323195 | - | 474 | WP_003023524.1 | transcription elongation factor GreB | - |
| LQ142_RS01500 (323421) | 323421..324140 | + | 720 | WP_001157751.1 | two-component system response regulator OmpR | - |
| LQ142_RS01505 (324137) | 324137..325489 | + | 1353 | WP_003837891.1 | two-component system sensor histidine kinase EnvZ | - |
| LQ142_RS01510 (325546) | 325546..325842 | - | 297 | WP_003837894.1 | NadS family protein | Antitoxin |
| LQ142_RS01515 (325895) | 325895..326212 | - | 318 | WP_003847996.1 | hypothetical protein | Toxin |
| LQ142_RS01520 (326335) | 326335..327957 | - | 1623 | WP_003023529.1 | phosphoenolpyruvate carboxykinase (ATP) | - |
| LQ142_RS01525 (328336) | 328336..330054 | + | 1719 | WP_047715944.1 | DUF4153 domain-containing protein | - |
| LQ142_RS01530 (330164) | 330164..331042 | - | 879 | WP_003023531.1 | Hsp33 family molecular chaperone HslO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12225.15 Da Isoelectric Point: 10.0909
>T296194 WP_003847996.1 NZ_OW969904:c326212-325895 [Citrobacter freundii]
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
MFTFIELQGFSKRRPLLLPDDEFRAFQEALIENPEAGDTIAGTGGFRKIRWSRSGMGKRSGIRVIYYNVTRKGRIYLALL
YPKNEQDDLTEEQKRVLMHLSNMLI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B5Q945 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U6IRD5 |