Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 40128..40776 | Replicon | chromosome |
Accession | NZ_OW969904 | ||
Organism | Citrobacter freundii isolate 0 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0D7M266 |
Locus tag | LQ142_RS00185 | Protein ID | WP_016151211.1 |
Coordinates | 40128..40490 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A8B5QFP8 |
Locus tag | LQ142_RS00190 | Protein ID | WP_003844470.1 |
Coordinates | 40477..40776 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ142_RS00170 (36587) | 36587..37915 | + | 1329 | WP_003023927.1 | MFS transporter | - |
LQ142_RS00175 (38058) | 38058..39449 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
LQ142_RS00180 (39575) | 39575..40027 | + | 453 | WP_003023933.1 | DUF1198 family protein | - |
LQ142_RS00185 (40128) | 40128..40490 | + | 363 | WP_016151211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ142_RS00190 (40477) | 40477..40776 | + | 300 | WP_003844470.1 | XRE family transcriptional regulator | Antitoxin |
LQ142_RS00195 (40895) | 40895..42085 | + | 1191 | WP_032937137.1 | purine ribonucleoside efflux pump NepI | - |
LQ142_RS00200 (42135) | 42135..43517 | - | 1383 | WP_205688238.1 | glycoside hydrolase family 1 protein | - |
LQ142_RS00205 (43612) | 43612..43905 | - | 294 | WP_003840665.1 | YicS family protein | - |
LQ142_RS00210 (44036) | 44036..44452 | + | 417 | WP_003023951.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13788.66 Da Isoelectric Point: 5.1976
>T296192 WP_016151211.1 NZ_OW969904:40128-40490 [Citrobacter freundii]
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
MWEVETTDAFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGSPIRAFFAFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLISKENYGYP
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0D7M266 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A8B5QFP8 |