Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2770186..2770920 | Replicon | chromosome |
Accession | NZ_OW969691 | ||
Organism | Citrobacter koseri isolate 0 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A8AI82 |
Locus tag | LQV22_RS13310 | Protein ID | WP_012132927.1 |
Coordinates | 2770615..2770920 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A8AI81 |
Locus tag | LQV22_RS13305 | Protein ID | WP_012132926.1 |
Coordinates | 2770186..2770527 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQV22_RS13280 (2765671) | 2765671..2766294 | - | 624 | WP_112002282.1 | DsbA family protein | - |
LQV22_RS13285 (2766291) | 2766291..2768177 | - | 1887 | WP_112002283.1 | protein-disulfide reductase DsbD family protein | - |
LQV22_RS13290 (2768226) | 2768226..2768591 | - | 366 | WP_047457658.1 | hypothetical protein | - |
LQV22_RS13295 (2768821) | 2768821..2769741 | + | 921 | WP_047457661.1 | curved DNA-binding protein | - |
LQV22_RS13300 (2769741) | 2769741..2770046 | + | 306 | WP_112002284.1 | chaperone modulator CbpM | - |
LQV22_RS13305 (2770186) | 2770186..2770527 | - | 342 | WP_012132926.1 | HigA family addiction module antitoxin | Antitoxin |
LQV22_RS13310 (2770615) | 2770615..2770920 | - | 306 | WP_012132927.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQV22_RS13315 (2771157) | 2771157..2772263 | + | 1107 | WP_112002286.1 | 4Fe-4S binding protein | - |
LQV22_RS13320 (2772297) | 2772297..2773073 | - | 777 | WP_230032155.1 | ABC transporter ATP-binding protein | - |
LQV22_RS13325 (2773073) | 2773073..2773843 | - | 771 | WP_058668982.1 | ABC transporter permease | - |
LQV22_RS13330 (2773840) | 2773840..2774847 | - | 1008 | WP_049009338.1 | ABC transporter substrate-binding protein | - |
LQV22_RS13335 (2774876) | 2774876..2775595 | - | 720 | WP_012132933.1 | aspartate/glutamate racemase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11972.70 Da Isoelectric Point: 8.3565
>T296167 WP_012132927.1 NZ_OW969691:c2770920-2770615 [Citrobacter koseri]
MPKKLVSIEDFRDQWLDDFFMYSAPHKKIPPDIHSALARKLDIINAAVSYKDLKSPPGNRYEELEGKLQEYSSIRVNKQY
RLIFKWVNGKAQDLYLDPHEY
MPKKLVSIEDFRDQWLDDFFMYSAPHKKIPPDIHSALARKLDIINAAVSYKDLKSPPGNRYEELEGKLQEYSSIRVNKQY
RLIFKWVNGKAQDLYLDPHEY
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|