Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 28306..28718 | Replicon | plasmid P1 |
| Accession | NZ_OW968329 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LQ108_RS23390 | Protein ID | WP_223200913.1 |
| Coordinates | 28596..28718 (+) | Length | 41 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 28306..28491 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS23355 (24013) | 24013..24534 | + | 522 | WP_000290794.1 | single-stranded DNA-binding protein | - |
| LQ108_RS23360 (24590) | 24590..24823 | + | 234 | WP_000005971.1 | DUF905 domain-containing protein | - |
| LQ108_RS23365 (24884) | 24884..26833 | + | 1950 | WP_000109422.1 | ParB/RepB/Spo0J family partition protein | - |
| LQ108_RS23370 (26888) | 26888..27322 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| LQ108_RS23375 (27319) | 27319..28038 | + | 720 | WP_000116349.1 | plasmid SOS inhibition protein A | - |
| LQ108_RS23380 (28035) | 28035..28349 | + | 315 | WP_000872086.1 | hypothetical protein | - |
| - (28306) | 28306..28491 | + | 186 | NuclAT_0 | - | Antitoxin |
| - (28306) | 28306..28491 | + | 186 | NuclAT_0 | - | Antitoxin |
| - (28306) | 28306..28491 | + | 186 | NuclAT_0 | - | Antitoxin |
| - (28306) | 28306..28491 | + | 186 | NuclAT_0 | - | Antitoxin |
| LQ108_RS23385 (28499) | 28499..28651 | + | 153 | Protein_36 | DUF5431 family protein | - |
| LQ108_RS23390 (28596) | 28596..28718 | + | 123 | WP_223200913.1 | Hok/Gef family protein | Toxin |
| LQ108_RS23395 (29019) | 29019..29268 | - | 250 | Protein_38 | hypothetical protein | - |
| LQ108_RS23400 (29564) | 29564..29887 | + | 324 | WP_000533253.1 | hypothetical protein | - |
| LQ108_RS23405 (29946) | 29946..30188 | + | 243 | WP_000540588.1 | hypothetical protein | - |
| LQ108_RS23410 (30454) | 30454..30744 | + | 291 | WP_073972341.1 | hypothetical protein | - |
| LQ108_RS23415 (31215) | 31215..31511 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| LQ108_RS23420 (31621) | 31621..32442 | + | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| LQ108_RS23425 (32739) | 32739..33341 | - | 603 | WP_077761845.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..72965 | 72965 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4538.38 Da Isoelectric Point: 8.2691
>T296103 WP_223200913.1 NZ_OW968329:28596-28718 [Enterobacter cloacae]
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
IVCCTLLIFTLLTRNRLCEVRLKDGYREVTATMAYESGGK
Download Length: 123 bp
Antitoxin
Download Length: 186 bp
>AT296103 NZ_OW968329:28306-28491 [Enterobacter cloacae]
CCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGGATATGAGCTATGATGTG
CCCGGCGCTTGAGGCTTTTTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGCAGAAAGCCCCGT
AGTTAATTTTCATTAACCCACGAGGC
CCCGTGAACTGGCTGAACGACCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGGATATGAGCTATGATGTG
CCCGGCGCTTGAGGCTTTTTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGCAGAAAGCCCCGT
AGTTAATTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|