Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1138448..1139097 | Replicon | chromosome |
Accession | NZ_OW968328 | ||
Organism | Enterobacter cloacae isolate 1382 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | LQ108_RS05355 | Protein ID | WP_230134505.1 |
Coordinates | 1138735..1139097 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A5E1A3P3 |
Locus tag | LQ108_RS05350 | Protein ID | WP_013097693.1 |
Coordinates | 1138448..1138747 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ108_RS05340 (AI2999V1_1037) | 1134860..1136833 | + | 1974 | WP_230134501.1 | PhoX family phosphatase | - |
LQ108_RS05345 (AI2999V1_1038) | 1136936..1138324 | + | 1389 | WP_230134503.1 | phenylalanine transporter | - |
LQ108_RS05350 (AI2999V1_1039) | 1138448..1138747 | - | 300 | WP_013097693.1 | helix-turn-helix transcriptional regulator | Antitoxin |
LQ108_RS05355 (AI2999V1_1040) | 1138735..1139097 | - | 363 | WP_230134505.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
LQ108_RS05360 (AI2999V1_1041) | 1139303..1140541 | + | 1239 | WP_230134507.1 | MFS transporter | - |
LQ108_RS05365 (AI2999V1_1042) | 1140557..1141582 | + | 1026 | WP_205918994.1 | sugar phosphate isomerase/epimerase | - |
LQ108_RS05370 (AI2999V1_1043) | 1141575..1142717 | + | 1143 | WP_029882611.1 | Gfo/Idh/MocA family oxidoreductase | - |
LQ108_RS05375 (AI2999V1_1044) | 1142793..1143764 | + | 972 | WP_218656501.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13959.99 Da Isoelectric Point: 7.3235
>T296093 WP_230134505.1 NZ_OW968328:c1139097-1138735 [Enterobacter cloacae]
MWNVETTDRFDEWFLEQTTALKEDVLAAMHILSEFGPQLGRPFVDTVKASAFGNMKELRIQHRGNPIRAFFAFDPDRKAI
VLCAGDKTGCNQKRFYKEMIALADVEYHRHLANKEAIWQR
MWNVETTDRFDEWFLEQTTALKEDVLAAMHILSEFGPQLGRPFVDTVKASAFGNMKELRIQHRGNPIRAFFAFDPDRKAI
VLCAGDKTGCNQKRFYKEMIALADVEYHRHLANKEAIWQR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|