Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 30747..31477 | Replicon | chromosome |
| Accession | NZ_OW968328 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7Z1J9A0 |
| Locus tag | LQ108_RS00155 | Protein ID | WP_020684666.1 |
| Coordinates | 30747..31061 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ108_RS00160 | Protein ID | WP_028027984.1 |
| Coordinates | 31061..31477 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS00130 (AI2999V1_0026) | 26411..27499 | + | 1089 | WP_230134080.1 | cellulase family glycosylhydrolase | - |
| LQ108_RS00135 (AI2999V1_0027) | 27402..28586 | - | 1185 | WP_038420858.1 | multidrug efflux MFS transporter EmrD | - |
| LQ108_RS00140 (AI2999V1_0028) | 28762..29595 | - | 834 | WP_029881854.1 | EamA family transporter | - |
| LQ108_RS00145 (AI2999V1_0029) | 29658..30104 | - | 447 | WP_013094803.1 | GNAT family N-acetyltransferase | - |
| LQ108_RS00150 (AI2999V1_0030) | 30169..30258 | - | 90 | WP_020684667.1 | type I toxin-antitoxin system toxin TisB | - |
| LQ108_RS00155 (AI2999V1_0031) | 30747..31061 | + | 315 | WP_020684666.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| LQ108_RS00160 (AI2999V1_0032) | 31061..31477 | + | 417 | WP_028027984.1 | helix-turn-helix domain-containing protein | Antitoxin |
| LQ108_RS00165 (AI2999V1_0033) | 31624..31722 | + | 99 | WP_071830013.1 | ilvB operon leader peptide IvbL | - |
| LQ108_RS00170 (AI2999V1_0034) | 31827..33515 | + | 1689 | WP_023620622.1 | acetolactate synthase large subunit | - |
| LQ108_RS00175 (AI2999V1_0035) | 33519..33806 | + | 288 | WP_001171659.1 | acetolactate synthase small subunit | - |
| LQ108_RS00180 (AI2999V1_0036) | 33889..34482 | + | 594 | WP_013094809.1 | transcriptional regulator UhpA | - |
| LQ108_RS00185 (AI2999V1_0037) | 34479..35984 | + | 1506 | WP_013094810.1 | signal transduction histidine-protein kinase/phosphatase UhpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12367.51 Da Isoelectric Point: 10.2509
>T296088 WP_020684666.1 NZ_OW968328:30747-31061 [Enterobacter cloacae]
MHLISMKAILDAVIQFPQHREELLVLGRTLEKSHCPTPAALKKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
MHLISMKAILDAVIQFPQHREELLVLGRTLEKSHCPTPAALKKLFPTLDNFKYLDKHYVIDIANNNLRVVALIFFESQKF
YVRHVFTHKEYDRFTEKHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15437.94 Da Isoelectric Point: 4.9597
>AT296088 WP_028027984.1 NZ_OW968328:31061-31477 [Enterobacter cloacae]
MIVADAMKATHALVEAVPLLGEQPSEKDYNDALELVEYLLINEPNSPLLDIVCARISRYEANRPEIVALRKEMELVPVGI
AVLRTLMDQYKLTTSDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLASRFGVSPALFIE
MIVADAMKATHALVEAVPLLGEQPSEKDYNDALELVEYLLINEPNSPLLDIVCARISRYEANRPEIVALRKEMELVPVGI
AVLRTLMDQYKLTTSDFQDEIGSKSMVSRVLNGQRQLTLNHIKKLASRFGVSPALFIE
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|