Detailed information of TA system TA296086

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 18883..19309
• Replicon: plasmid P4
• Accession: NZ_OW968292
• Organism: Escherichia coli isolate 10

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ134_RS25375
• Protein ID: WP_001372321.1
• Coordinates: 19184..19309 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	18883..19107 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ134_RS25330 (13928)	13928..14182	+	255	WP_230156187.1	hypothetical protein	-
LQ134_RS25335 (14080)	14080..14352	+	273	WP_230156189.1	hypothetical protein	-
LQ134_RS25340 (14826)	14826..15353	+	528	WP_023181061.1	single-stranded DNA-binding protein	-
LQ134_RS25345 (15411)	15411..15644	+	234	WP_023181060.1	DUF905 family protein	-
LQ134_RS25350 (15708)	15708..17666	+	1959	WP_023181059.1	ParB/RepB/Spo0J family partition protein	-
LQ134_RS25355 (17721)	17721..18155	+	435	WP_023181058.1	conjugation system SOS inhibitor PsiB	-
LQ134_RS25360 (18152)	18152..18914	+	763	Protein_26	plasmid SOS inhibition protein A	-
LQ134_RS25365 (18883)	18883..19071	-	189	WP_157930331.1	protein sok	-
- (19040)	19040..19105	+	66	NuclAT_1	-	-
- (19040)	19040..19105	-	66	NuclAT_0	-	-
- (18883)	18883..19107	+	225	NuclAT_0	-	Antitoxin
- (18883)	18883..19107	+	225	NuclAT_0	-	Antitoxin
- (18883)	18883..19107	+	225	NuclAT_0	-	Antitoxin
- (18883)	18883..19107	+	225	NuclAT_0	-	Antitoxin
- (18883)	18883..19107	-	225	NuclAT_0	-	-
LQ134_RS25370 (19093)	19093..19242	+	150	Protein_28	plasmid maintenance protein Mok	-
LQ134_RS25375 (19184)	19184..19309	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ134_RS25380 (19544)	19544..19903	-	360	WP_077990621.1	hypothetical protein	-
LQ134_RS25385 (20204)	20204..20491	+	288	WP_000107538.1	hypothetical protein	-
LQ134_RS25390 (20609)	20609..21430	+	822	WP_001234468.1	DUF932 domain-containing protein	-
LQ134_RS25395 (21727)	21727..22374	-	648	WP_000614934.1	transglycosylase SLT domain-containing protein	-
LQ134_RS25400 (22651)	22651..23034	+	384	WP_000124982.1	conjugal transfer relaxosome DNA-binding protein TraM	-
LQ134_RS25405 (23228)	23228..23914	+	687	WP_000332484.1	PAS domain-containing protein	-
LQ134_RS25410 (24008)	24008..24235	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T296086 WP_001372321.1 NZ_OW968292:19184-19309 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT296086 NZ_OW968292:18883-19107 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGCATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin