Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 44153..44417 Replicon plasmid P2
Accession NZ_OW968290
Organism Escherichia coli isolate 10

Toxin (Protein)


Gene name pndA Uniprot ID E6BRV3
Locus tag LQ134_RS24560 Protein ID WP_001303307.1
Coordinates 44265..44417 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 44153..44215 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ134_RS24545 (39392) 39392..41683 - 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -
LQ134_RS24550 (41676) 41676..42746 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
LQ134_RS24555 (42765) 42765..43973 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (44153) 44153..44215 - 63 NuclAT_0 - Antitoxin
- (44153) 44153..44215 - 63 NuclAT_0 - Antitoxin
- (44153) 44153..44215 - 63 NuclAT_0 - Antitoxin
- (44153) 44153..44215 - 63 NuclAT_0 - Antitoxin
LQ134_RS24560 (44265) 44265..44417 + 153 WP_001303307.1 Hok/Gef family protein Toxin
LQ134_RS24565 (44489) 44489..44740 - 252 WP_001291964.1 hypothetical protein -
LQ134_RS25775 (45239) 45239..45334 + 96 WP_001303310.1 DinQ-like type I toxin DqlB -
LQ134_RS24575 (45399) 45399..45575 - 177 WP_001054897.1 hypothetical protein -
LQ134_RS24580 (45967) 45967..46176 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
LQ134_RS24585 (46248) 46248..46898 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
LQ134_RS24590 (46972) 46972..49140 - 2169 WP_001774191.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..90448 90448


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5817.21 Da        Isoelectric Point: 8.7948

>T296082 WP_001303307.1 NZ_OW968290:44265-44417 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT296082 NZ_OW968290:c44215-44153 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A634Q5L1

Antitoxin

Download structure file

References