Detailed information of TA system TA296078

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 104747..105173
• Replicon: plasmid P1
• Accession: NZ_OW968289
• Organism: Escherichia coli isolate 10

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ134_RS24140
• Protein ID: WP_001372321.1
• Coordinates: 104747..104872 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	104949..105173 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ134_RS24100 (101572)	101572..101799	+	228	WP_000450520.1	toxin-antitoxin system antitoxin VapB	-
LQ134_RS24105 (101799)	101799..102197	+	399	WP_000911313.1	type II toxin-antitoxin system VapC family toxin	-
LQ134_RS25770 (102206)	102206..102337	-	132	WP_281440571.1	hypothetical protein	-
LQ134_RS24110 (102410)	102410..103114	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
LQ134_RS24115 (103179)	103179..103421	-	243	Protein_110	DUF932 domain-containing protein	-
LQ134_RS24120 (103539)	103539..103826	-	288	WP_000107535.1	hypothetical protein	-
LQ134_RS24125 (103851)	103851..104057	-	207	WP_000547968.1	hypothetical protein	-
LQ134_RS24130 (104127)	104127..104299	+	173	Protein_113	hypothetical protein	-
LQ134_RS24135 (104297)	104297..104527	-	231	WP_071586998.1	hypothetical protein	-
LQ134_RS24140 (104747)	104747..104872	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ134_RS24145 (104814)	104814..104963	-	150	Protein_116	plasmid maintenance protein Mok	-
- (104949)	104949..105173	-	225	NuclAT_0	-	Antitoxin
- (104949)	104949..105173	-	225	NuclAT_0	-	Antitoxin
- (104949)	104949..105173	-	225	NuclAT_0	-	Antitoxin
- (104949)	104949..105173	-	225	NuclAT_0	-	Antitoxin
LQ134_RS24150 (104985)	104985..105173	+	189	WP_001299721.1	hypothetical protein	-
LQ134_RS24155 (105142)	105142..105904	-	763	Protein_118	plasmid SOS inhibition protein A	-
LQ134_RS24160 (105901)	105901..106335	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
LQ134_RS24165 (106390)	106390..106587	-	198	Protein_120	hypothetical protein	-
LQ134_RS24170 (106615)	106615..106848	-	234	WP_000005987.1	DUF905 family protein	-
LQ134_RS24175 (106916)	106916..107455	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
LQ134_RS24180 (107481)	107481..107687	-	207	WP_000275856.1	hypothetical protein	-
LQ134_RS24185 (107757)	107757..107837	+	81	Protein_124	hypothetical protein	-
LQ134_RS24190 (108020)	108020..108189	-	170	Protein_125	hypothetical protein	-
LQ134_RS24195 (108740)	108740..109711	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sul1 / qacE / aadA5 / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..130092	130092

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T296078 WP_001372321.1 NZ_OW968289:c104872-104747 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT296078 NZ_OW968289:c105173-104949 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin