Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3785720..3786414 | Replicon | chromosome |
Accession | NZ_OW968288 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | LQ134_RS18445 | Protein ID | WP_001263489.1 |
Coordinates | 3785720..3786118 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | LQ134_RS18450 | Protein ID | WP_000554758.1 |
Coordinates | 3786121..3786414 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3781308) | 3781308..3781388 | - | 81 | NuclAT_11 | - | - |
- (3781308) | 3781308..3781388 | - | 81 | NuclAT_11 | - | - |
- (3781308) | 3781308..3781388 | - | 81 | NuclAT_11 | - | - |
- (3781308) | 3781308..3781388 | - | 81 | NuclAT_11 | - | - |
LQ134_RS18420 (3781984) | 3781984..3782442 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
LQ134_RS18425 (3782703) | 3782703..3784160 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
LQ134_RS18430 (3784217) | 3784217..3784738 | - | 522 | Protein_3627 | peptide chain release factor H | - |
LQ134_RS18435 (3784734) | 3784734..3784940 | - | 207 | Protein_3628 | RtcB family protein | - |
LQ134_RS18440 (3785258) | 3785258..3785710 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
LQ134_RS18445 (3785720) | 3785720..3786118 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
LQ134_RS18450 (3786121) | 3786121..3786414 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
LQ134_RS18455 (3786466) | 3786466..3787521 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
LQ134_RS18460 (3787592) | 3787592..3788377 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
LQ134_RS18465 (3788349) | 3788349..3790061 | + | 1713 | Protein_3634 | flagellar biosynthesis protein FlhA | - |
LQ134_RS18470 (3790285) | 3790285..3790782 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T296072 WP_001263489.1 NZ_OW968288:c3786118-3785720 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |