296039

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5139348..5139569 Replicon chromosome
Accession NZ_OW968277
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag LQ166_RS25185 Protein ID WP_001531632.1
Coordinates 5139348..5139455 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5139503..5139569 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ166_RS25160 (5135192) 5135192..5136274 + 1083 WP_000804726.1 peptide chain release factor 1 -
LQ166_RS25165 (5136274) 5136274..5137107 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
LQ166_RS25170 (5137104) 5137104..5137496 + 393 WP_000200375.1 invasion regulator SirB2 -
LQ166_RS25175 (5137500) 5137500..5138309 + 810 WP_001257044.1 invasion regulator SirB1 -
LQ166_RS25180 (5138345) 5138345..5139199 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LQ166_RS25185 (5139348) 5139348..5139455 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5139505) 5139505..5139568 + 64 NuclAT_12 - -
- (5139505) 5139505..5139568 + 64 NuclAT_12 - -
- (5139505) 5139505..5139568 + 64 NuclAT_12 - -
- (5139505) 5139505..5139568 + 64 NuclAT_12 - -
- (5139505) 5139505..5139568 + 64 NuclAT_13 - -
- (5139505) 5139505..5139568 + 64 NuclAT_13 - -
- (5139505) 5139505..5139568 + 64 NuclAT_13 - -
- (5139505) 5139505..5139568 + 64 NuclAT_13 - -
- (5139505) 5139505..5139568 + 64 NuclAT_14 - -
- (5139505) 5139505..5139568 + 64 NuclAT_14 - -
- (5139505) 5139505..5139568 + 64 NuclAT_14 - -
- (5139505) 5139505..5139568 + 64 NuclAT_14 - -
- (5139505) 5139505..5139568 + 64 NuclAT_15 - -
- (5139505) 5139505..5139568 + 64 NuclAT_15 - -
- (5139505) 5139505..5139568 + 64 NuclAT_15 - -
- (5139505) 5139505..5139568 + 64 NuclAT_15 - -
- (5139505) 5139505..5139568 + 64 NuclAT_16 - -
- (5139505) 5139505..5139568 + 64 NuclAT_16 - -
- (5139505) 5139505..5139568 + 64 NuclAT_16 - -
- (5139505) 5139505..5139568 + 64 NuclAT_16 - -
- (5139505) 5139505..5139568 + 64 NuclAT_17 - -
- (5139505) 5139505..5139568 + 64 NuclAT_17 - -
- (5139505) 5139505..5139568 + 64 NuclAT_17 - -
- (5139505) 5139505..5139568 + 64 NuclAT_17 - -
- (5139503) 5139503..5139569 + 67 NuclAT_10 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_10 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_10 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_10 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_5 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_5 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_5 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_5 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_6 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_6 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_6 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_6 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_7 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_7 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_7 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_7 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_8 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_8 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_8 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_8 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_9 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_9 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_9 - Antitoxin
- (5139503) 5139503..5139569 + 67 NuclAT_9 - Antitoxin
- (5139505) 5139505..5139570 + 66 NuclAT_18 - -
- (5139505) 5139505..5139570 + 66 NuclAT_18 - -
- (5139505) 5139505..5139570 + 66 NuclAT_18 - -
- (5139505) 5139505..5139570 + 66 NuclAT_18 - -
- (5139505) 5139505..5139570 + 66 NuclAT_19 - -
- (5139505) 5139505..5139570 + 66 NuclAT_19 - -
- (5139505) 5139505..5139570 + 66 NuclAT_19 - -
- (5139505) 5139505..5139570 + 66 NuclAT_19 - -
- (5139505) 5139505..5139570 + 66 NuclAT_20 - -
- (5139505) 5139505..5139570 + 66 NuclAT_20 - -
- (5139505) 5139505..5139570 + 66 NuclAT_20 - -
- (5139505) 5139505..5139570 + 66 NuclAT_20 - -
- (5139505) 5139505..5139570 + 66 NuclAT_21 - -
- (5139505) 5139505..5139570 + 66 NuclAT_21 - -
- (5139505) 5139505..5139570 + 66 NuclAT_21 - -
- (5139505) 5139505..5139570 + 66 NuclAT_21 - -
- (5139505) 5139505..5139570 + 66 NuclAT_22 - -
- (5139505) 5139505..5139570 + 66 NuclAT_22 - -
- (5139505) 5139505..5139570 + 66 NuclAT_22 - -
- (5139505) 5139505..5139570 + 66 NuclAT_22 - -
- (5139505) 5139505..5139570 + 66 NuclAT_23 - -
- (5139505) 5139505..5139570 + 66 NuclAT_23 - -
- (5139505) 5139505..5139570 + 66 NuclAT_23 - -
- (5139505) 5139505..5139570 + 66 NuclAT_23 - -
LQ166_RS25190 (5139860) 5139860..5140960 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
LQ166_RS25195 (5141230) 5141230..5141469 + 240 WP_000120702.1 putative cation transport regulator ChaB -
LQ166_RS25200 (5141618) 5141618..5142313 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
LQ166_RS25205 (5142357) 5142357..5142710 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
LQ166_RS25210 (5142895) 5142895..5144289 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T296039 WP_001531632.1 NZ_OW968277:c5139455-5139348 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT296039 NZ_OW968277:5139503-5139569 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References