Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 3642660..3643387 | Replicon | chromosome |
| Accession | NZ_OW968277 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | LQ166_RS17945 | Protein ID | WP_000550189.1 |
| Coordinates | 3642660..3642974 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ166_RS17950 | Protein ID | WP_000560269.1 |
| Coordinates | 3642971..3643387 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS17925 (3638817) | 3638817..3639803 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
| LQ166_RS17930 (3639882) | 3639882..3640574 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
| LQ166_RS17935 (3640651) | 3640651..3641154 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| LQ166_RS17940 (3641239) | 3641239..3642375 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| LQ166_RS17945 (3642660) | 3642660..3642974 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| LQ166_RS17950 (3642971) | 3642971..3643387 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| LQ166_RS17955 (3643432) | 3643432..3645450 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| LQ166_RS17960 (3645676) | 3645676..3648027 | - | 2352 | WP_000695432.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T296036 WP_000550189.1 NZ_OW968277:3642660-3642974 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT296036 WP_000560269.1 NZ_OW968277:3642971-3643387 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|