Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3602133..3602932 | Replicon | chromosome |
Accession | NZ_OW968277 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | LQ166_RS17725 | Protein ID | WP_000347251.1 |
Coordinates | 3602133..3602597 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | LQ166_RS17730 | Protein ID | WP_001296435.1 |
Coordinates | 3602597..3602932 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ166_RS17695 (3597134) | 3597134..3597568 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
LQ166_RS17700 (3597586) | 3597586..3598464 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
LQ166_RS17705 (3598454) | 3598454..3599233 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
LQ166_RS17710 (3599244) | 3599244..3599717 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
LQ166_RS17715 (3599740) | 3599740..3601020 | - | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
LQ166_RS17720 (3601269) | 3601269..3602078 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
LQ166_RS17725 (3602133) | 3602133..3602597 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
LQ166_RS17730 (3602597) | 3602597..3602932 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
LQ166_RS17735 (3603081) | 3603081..3604652 | - | 1572 | WP_001273763.1 | galactarate dehydratase | - |
LQ166_RS17740 (3605027) | 3605027..3606361 | + | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
LQ166_RS17745 (3606377) | 3606377..3607147 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T296035 WP_000347251.1 NZ_OW968277:c3602597-3602133 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PPV5 |