Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2791652..2792254 | Replicon | chromosome |
| Accession | NZ_OW968277 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | LQ166_RS13770 | Protein ID | WP_000897302.1 |
| Coordinates | 2791943..2792254 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LQ166_RS13765 | Protein ID | WP_000356397.1 |
| Coordinates | 2791652..2791942 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS13735 (2786959) | 2786959..2787888 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ166_RS13740 (2788070) | 2788070..2788312 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| LQ166_RS13745 (2788602) | 2788602..2789450 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| LQ166_RS13750 (2789475) | 2789475..2790215 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| LQ166_RS13755 (2790400) | 2790400..2790618 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| LQ166_RS13760 (2791015) | 2791015..2791293 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| LQ166_RS13765 (2791652) | 2791652..2791942 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| LQ166_RS13770 (2791943) | 2791943..2792254 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| LQ166_RS13775 (2792483) | 2792483..2793391 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| LQ166_RS13780 (2793455) | 2793455..2794396 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| LQ166_RS13785 (2794441) | 2794441..2794878 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| LQ166_RS13790 (2794875) | 2794875..2795747 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| LQ166_RS13795 (2795741) | 2795741..2796340 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T296033 WP_000897302.1 NZ_OW968277:c2792254-2791943 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|