Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1486062..1486741 | Replicon | chromosome |
| Accession | NZ_OW968277 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | LQ166_RS07570 | Protein ID | WP_000057523.1 |
| Coordinates | 1486439..1486741 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | LQ166_RS07565 | Protein ID | WP_000806442.1 |
| Coordinates | 1486062..1486403 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS07555 (1482306) | 1482306..1483238 | - | 933 | WP_000883041.1 | glutaminase A | - |
| LQ166_RS07560 (1483500) | 1483500..1486004 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| LQ166_RS07565 (1486062) | 1486062..1486403 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| LQ166_RS07570 (1486439) | 1486439..1486741 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ166_RS07575 (1486874) | 1486874..1487668 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| LQ166_RS07580 (1487872) | 1487872..1488351 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| LQ166_RS07585 (1488375) | 1488375..1489175 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| LQ166_RS07590 (1489172) | 1489172..1489675 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| LQ166_RS07595 (1489713) | 1489713..1491365 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T296024 WP_000057523.1 NZ_OW968277:c1486741-1486439 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|