Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 56022..56286 | Replicon | plasmid P2 |
| Accession | NZ_OW968126 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | LQ159_RS24565 | Protein ID | WP_001303307.1 |
| Coordinates | 56134..56286 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 56022..56084 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ159_RS24550 (52124) | 52124..53194 | - | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| LQ159_RS24555 (53213) | 53213..54421 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (54601) | 54601..54661 | - | 61 | NuclAT_1 | - | - |
| - (54601) | 54601..54661 | - | 61 | NuclAT_1 | - | - |
| - (54601) | 54601..54661 | - | 61 | NuclAT_1 | - | - |
| - (54601) | 54601..54661 | - | 61 | NuclAT_1 | - | - |
| LQ159_RS24560 (54728) | 54728..55507 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (56022) | 56022..56084 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (56022) | 56022..56084 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (56022) | 56022..56084 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (56022) | 56022..56084 | - | 63 | NuclAT_0 | - | Antitoxin |
| LQ159_RS24565 (56134) | 56134..56286 | + | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| LQ159_RS24570 (56358) | 56358..56609 | - | 252 | WP_001291968.1 | hypothetical protein | - |
| - (56996) | 56996..57047 | - | 52 | NuclAT_2 | - | - |
| - (56996) | 56996..57047 | - | 52 | NuclAT_2 | - | - |
| - (56996) | 56996..57047 | - | 52 | NuclAT_2 | - | - |
| - (56996) | 56996..57047 | - | 52 | NuclAT_2 | - | - |
| LQ159_RS24575 (57533) | 57533..57709 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| LQ159_RS24580 (57918) | 57918..58127 | - | 210 | WP_001140545.1 | hemolysin expression modulator Hha | - |
| LQ159_RS24585 (58225) | 58225..58839 | - | 615 | WP_000578649.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| LQ159_RS24590 (58915) | 58915..61083 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-14 | - | 1..103714 | 103714 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T296013 WP_001303307.1 NZ_OW968126:56134-56286 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT296013 NZ_OW968126:c56084-56022 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|