Detailed information of TA system TA296010

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 81448..81874
• Replicon: plasmid P1
• Accession: NZ_OW968125
• Organism: Escherichia coli isolate 10

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ159_RS24095
• Protein ID: WP_001372321.1
• Coordinates: 81448..81573 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	81650..81874 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ159_RS24050 (78273)	78273..78500	+	228	WP_000450520.1	toxin-antitoxin system antitoxin VapB	-
LQ159_RS24055 (78500)	78500..78898	+	399	WP_000911313.1	type II toxin-antitoxin system VapC family toxin	-
LQ159_RS24060 (78907)	78907..79044	-	138	WP_230163687.1	hypothetical protein	-
LQ159_RS24065 (79111)	79111..79815	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
LQ159_RS24070 (79880)	79880..80122	-	243	Protein_82	DUF932 domain-containing protein	-
LQ159_RS24075 (80240)	80240..80527	-	288	WP_000107535.1	hypothetical protein	-
LQ159_RS24080 (80552)	80552..80758	-	207	WP_000547968.1	hypothetical protein	-
LQ159_RS24085 (80828)	80828..81000	+	173	Protein_85	hypothetical protein	-
LQ159_RS24090 (80998)	80998..81228	-	231	WP_071586998.1	hypothetical protein	-
LQ159_RS24095 (81448)	81448..81573	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ159_RS24100 (81515)	81515..81664	-	150	Protein_88	plasmid maintenance protein Mok	-
- (81650)	81650..81874	-	225	NuclAT_0	-	Antitoxin
- (81650)	81650..81874	-	225	NuclAT_0	-	Antitoxin
- (81650)	81650..81874	-	225	NuclAT_0	-	Antitoxin
- (81650)	81650..81874	-	225	NuclAT_0	-	Antitoxin
LQ159_RS24105 (81686)	81686..81874	+	189	WP_001299721.1	hypothetical protein	-
LQ159_RS24110 (81843)	81843..82605	-	763	Protein_90	plasmid SOS inhibition protein A	-
LQ159_RS24115 (82602)	82602..83036	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
LQ159_RS24120 (83091)	83091..83288	-	198	Protein_92	hypothetical protein	-
LQ159_RS24125 (83316)	83316..83549	-	234	WP_000005987.1	DUF905 family protein	-
LQ159_RS24130 (83617)	83617..84156	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
LQ159_RS24135 (84182)	84182..84388	-	207	WP_000275856.1	hypothetical protein	-
LQ159_RS24140 (84458)	84458..84538	+	81	Protein_96	hypothetical protein	-
LQ159_RS24145 (84721)	84721..84890	-	170	Protein_97	hypothetical protein	-
LQ159_RS24150 (85484)	85484..86455	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..106836	106836

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T296010 WP_001372321.1 NZ_OW968125:c81573-81448 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT296010 NZ_OW968125:c81874-81650 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin