Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 81448..81874 | Replicon | plasmid P1 |
| Accession | NZ_OW968125 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LQ159_RS24095 | Protein ID | WP_001372321.1 |
| Coordinates | 81448..81573 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 81650..81874 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ159_RS24050 (78273) | 78273..78500 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | - |
| LQ159_RS24055 (78500) | 78500..78898 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | - |
| LQ159_RS24060 (78907) | 78907..79044 | - | 138 | WP_230163687.1 | hypothetical protein | - |
| LQ159_RS24065 (79111) | 79111..79815 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ159_RS24070 (79880) | 79880..80122 | - | 243 | Protein_82 | DUF932 domain-containing protein | - |
| LQ159_RS24075 (80240) | 80240..80527 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| LQ159_RS24080 (80552) | 80552..80758 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| LQ159_RS24085 (80828) | 80828..81000 | + | 173 | Protein_85 | hypothetical protein | - |
| LQ159_RS24090 (80998) | 80998..81228 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| LQ159_RS24095 (81448) | 81448..81573 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LQ159_RS24100 (81515) | 81515..81664 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | Antitoxin |
| LQ159_RS24105 (81686) | 81686..81874 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| LQ159_RS24110 (81843) | 81843..82605 | - | 763 | Protein_90 | plasmid SOS inhibition protein A | - |
| LQ159_RS24115 (82602) | 82602..83036 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| LQ159_RS24120 (83091) | 83091..83288 | - | 198 | Protein_92 | hypothetical protein | - |
| LQ159_RS24125 (83316) | 83316..83549 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| LQ159_RS24130 (83617) | 83617..84156 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| LQ159_RS24135 (84182) | 84182..84388 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| LQ159_RS24140 (84458) | 84458..84538 | + | 81 | Protein_96 | hypothetical protein | - |
| LQ159_RS24145 (84721) | 84721..84890 | - | 170 | Protein_97 | hypothetical protein | - |
| LQ159_RS24150 (85484) | 85484..86455 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..106836 | 106836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T296010 WP_001372321.1 NZ_OW968125:c81573-81448 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT296010 NZ_OW968125:c81874-81650 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|