Detailed information of TA system TA295983

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 134926..135352
• Replicon: plasmid P1
• Accession: NZ_OW968112
• Organism: Escherichia coli isolate 602

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: LQ120_RS23885
• Protein ID: WP_001372321.1
• Coordinates: 134926..135051 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	135128..135352 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
LQ120_RS23840 (130215)	130215..130451	+	237	WP_000993386.1	broad-spectrum mercury transporter MerE	-
LQ120_RS23845 (130487)	130487..131155	+	669	WP_001300294.1	EAL domain-containing protein	-
LQ120_RS23850 (131230)	131230..132480	+	1251	Protein_145	transposase	-
LQ120_RS23855 (132545)	132545..133249	+	705	WP_001067855.1	IS6-like element IS26 family transposase	-
LQ120_RS23860 (133292)	133292..133600	-	309	Protein_147	DUF932 domain-containing protein	-
LQ120_RS23865 (133718)	133718..134005	-	288	WP_000107535.1	hypothetical protein	-
LQ120_RS23870 (134030)	134030..134236	-	207	WP_000547968.1	hypothetical protein	-
LQ120_RS23875 (134306)	134306..134478	+	173	Protein_150	hypothetical protein	-
LQ120_RS23880 (134476)	134476..134706	-	231	WP_071586998.1	hypothetical protein	-
LQ120_RS23885 (134926)	134926..135051	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
LQ120_RS23890 (134993)	134993..135142	-	150	Protein_153	plasmid maintenance protein Mok	-
- (135128)	135128..135352	-	225	NuclAT_0	-	Antitoxin
- (135128)	135128..135352	-	225	NuclAT_0	-	Antitoxin
- (135128)	135128..135352	-	225	NuclAT_0	-	Antitoxin
- (135128)	135128..135352	-	225	NuclAT_0	-	Antitoxin
LQ120_RS23895 (135164)	135164..135352	+	189	WP_001299721.1	hypothetical protein	-
LQ120_RS23900 (135321)	135321..136083	-	763	Protein_155	plasmid SOS inhibition protein A	-
LQ120_RS23905 (136080)	136080..136514	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
LQ120_RS23910 (136569)	136569..136766	-	198	Protein_157	hypothetical protein	-
LQ120_RS23915 (136794)	136794..137027	-	234	WP_000005987.1	DUF905 family protein	-
LQ120_RS23920 (137095)	137095..137634	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
LQ120_RS23925 (137660)	137660..137866	-	207	WP_000275856.1	hypothetical protein	-
LQ120_RS23930 (137936)	137936..138016	+	81	Protein_161	hypothetical protein	-
LQ120_RS23935 (138199)	138199..138368	-	170	Protein_162	hypothetical protein	-
LQ120_RS23940 (139005)	139005..139976	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	oqxA / oqxB / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..160357	160357
	-	flank	IS/Tn	-	-	132545..133249	704

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T295983 WP_001372321.1 NZ_OW968112:c135051-134926 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT295983 NZ_OW968112:c135352-135128 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin