Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 134926..135352 | Replicon | plasmid P1 |
| Accession | NZ_OW968112 | ||
| Organism | Escherichia coli isolate 602 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | LQ120_RS23885 | Protein ID | WP_001372321.1 |
| Coordinates | 134926..135051 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 135128..135352 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ120_RS23840 (130215) | 130215..130451 | + | 237 | WP_000993386.1 | broad-spectrum mercury transporter MerE | - |
| LQ120_RS23845 (130487) | 130487..131155 | + | 669 | WP_001300294.1 | EAL domain-containing protein | - |
| LQ120_RS23850 (131230) | 131230..132480 | + | 1251 | Protein_145 | transposase | - |
| LQ120_RS23855 (132545) | 132545..133249 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ120_RS23860 (133292) | 133292..133600 | - | 309 | Protein_147 | DUF932 domain-containing protein | - |
| LQ120_RS23865 (133718) | 133718..134005 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| LQ120_RS23870 (134030) | 134030..134236 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| LQ120_RS23875 (134306) | 134306..134478 | + | 173 | Protein_150 | hypothetical protein | - |
| LQ120_RS23880 (134476) | 134476..134706 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| LQ120_RS23885 (134926) | 134926..135051 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| LQ120_RS23890 (134993) | 134993..135142 | - | 150 | Protein_153 | plasmid maintenance protein Mok | - |
| - (135128) | 135128..135352 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135128) | 135128..135352 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135128) | 135128..135352 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (135128) | 135128..135352 | - | 225 | NuclAT_0 | - | Antitoxin |
| LQ120_RS23895 (135164) | 135164..135352 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| LQ120_RS23900 (135321) | 135321..136083 | - | 763 | Protein_155 | plasmid SOS inhibition protein A | - |
| LQ120_RS23905 (136080) | 136080..136514 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| LQ120_RS23910 (136569) | 136569..136766 | - | 198 | Protein_157 | hypothetical protein | - |
| LQ120_RS23915 (136794) | 136794..137027 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| LQ120_RS23920 (137095) | 137095..137634 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| LQ120_RS23925 (137660) | 137660..137866 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| LQ120_RS23930 (137936) | 137936..138016 | + | 81 | Protein_161 | hypothetical protein | - |
| LQ120_RS23935 (138199) | 138199..138368 | - | 170 | Protein_162 | hypothetical protein | - |
| LQ120_RS23940 (139005) | 139005..139976 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / oqxB / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..160357 | 160357 | |
| - | flank | IS/Tn | - | - | 132545..133249 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T295983 WP_001372321.1 NZ_OW968112:c135051-134926 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT295983 NZ_OW968112:c135352-135128 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|